PDB entry 1b57

View 1b57 on RCSB PDB site
Description: class ii fructose-1,6-bisphosphate aldolase in complex with phosphoglycolohydroxamate
Deposited on 1999-01-12, released 2000-01-07
The last revision prior to the SCOP 1.55 freeze date was dated 2000-01-07, with a file datestamp of 2000-01-06.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.192
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.55: d1b57a_
  • Chain 'B':
    Domains in SCOP 1.55: d1b57b_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1b57A (A:)
    skifdfvkpgvitgddvqkvfqvakennfalpavncvgtdsinavletaakvkapvivqf
    snggasfiagkgvksdvpqgaailgaisgahhvhqmaehygvpvilhtdhcakkllpwid
    glldagekhfaatgkplfsshmidlseeslqenieicskylermskigmtleielgctgg
    eedgvdnshmdasalytqpedvdyaytelskisprftiaasfgnvhgvykpgnvvltpti
    lrdsqeyvskkhnlphnslnfvfhggsgstaqeikdsvsygvvkmnidtdtqwatwegvl
    nyykaneaylqgqlgnpkgedqpnkkyydprvwlragqtsmiarlekafqelnaidvl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1b57A (A:)
    skifdfvkpgvitgddvqkvfqvakennfalpavncvgtdsinavletaakvkapvivqf
    snggasfiagkgvksdvpqgaailgaisgahhvhqmaehygvpvilhtdhcakkllpwid
    glldagekhfaatgkplfsshmidlseeslqenieicskylermskigmtleielgctgg
    eelytqpedvdyaytelskisprftiaasfgnvhgvykpgnvvltptilrdsqeyvskkh
    nlphnslnfvfhggsgstaqeikdsvsygvvkmnidtdtqwatwegvlnyykaneaylqg
    qlgnpkgedqpnkkyydprvwlragqtsmiarlekafqelnaidvl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1b57B (B:)
    skifdfvkpgvitgddvqkvfqvakennfalpavncvgtdsinavletaakvkapvivqf
    snggasfiagkgvksdvpqgaailgaisgahhvhqmaehygvpvilhtdhcakkllpwid
    glldagekhfaatgkplfsshmidlseeslqenieicskylermskigmtleielgctgg
    eedgvdnshmdasalytqpedvdyaytelskisprftiaasfgnvhgvykpgnvvltpti
    lrdsqeyvskkhnlphnslnfvfhggsgstaqeikdsvsygvvkmnidtdtqwatwegvl
    nyykaneaylqgqlgnpkgedqpnkkyydprvwlragqtsmiarlekafqelnaidvl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1b57B (B:)
    skifdfvkpgvitgddvqkvfqvakennfalpavncvgtdsinavletaakvkapvivqf
    snggasfiagkgvksdvpqgaailgaisgahhvhqmaehygvpvilhtdhcakkllpwid
    glldagekhfaatgkplfsshmidlseeslqenieicskylermskigmtleielgctgg
    eelytqpedvdyaytelskisprftiaasfgnvhgvykpgnvvltptilrdsqeyvskkh
    nlphnslnfvfhggsgstaqeikdsvsygvvkmnidtdtqwatwegvlnyykaneaylqg
    qlgnpkgedqpnkkyydprvwlragqtsmiarlekafqelnaidvl