PDB entry 1b57

View 1b57 on RCSB PDB site
Description: class II fructose-1,6-bisphosphate aldolase in complex with phosphoglycolohydroxamate
Class: lyase
Keywords: lyase, aldehyde, glycolysis
Deposited on 1999-01-12, released 2000-01-07
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.192
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (fructose-bisphosphate aldolase II)
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1b57a_
  • Chain 'B':
    Compound: protein (fructose-bisphosphate aldolase II)
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1b57b_
  • Heterogens: ZN, NA, CL, PGH, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1b57A (A:)
    skifdfvkpgvitgddvqkvfqvakennfalpavncvgtdsinavletaakvkapvivqf
    snggasfiagkgvksdvpqgaailgaisgahhvhqmaehygvpvilhtdhcakkllpwid
    glldagekhfaatgkplfsshmidlseeslqenieicskylermskigmtleielgctgg
    eedgvdnshmdasalytqpedvdyaytelskisprftiaasfgnvhgvykpgnvvltpti
    lrdsqeyvskkhnlphnslnfvfhggsgstaqeikdsvsygvvkmnidtdtqwatwegvl
    nyykaneaylqgqlgnpkgedqpnkkyydprvwlragqtsmiarlekafqelnaidvl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1b57A (A:)
    skifdfvkpgvitgddvqkvfqvakennfalpavncvgtdsinavletaakvkapvivqf
    snggasfiagkgvksdvpqgaailgaisgahhvhqmaehygvpvilhtdhcakkllpwid
    glldagekhfaatgkplfsshmidlseeslqenieicskylermskigmtleielgctgg
    eelytqpedvdyaytelskisprftiaasfgnvhgvykpgnvvltptilrdsqeyvskkh
    nlphnslnfvfhggsgstaqeikdsvsygvvkmnidtdtqwatwegvlnyykaneaylqg
    qlgnpkgedqpnkkyydprvwlragqtsmiarlekafqelnaidvl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1b57B (B:)
    skifdfvkpgvitgddvqkvfqvakennfalpavncvgtdsinavletaakvkapvivqf
    snggasfiagkgvksdvpqgaailgaisgahhvhqmaehygvpvilhtdhcakkllpwid
    glldagekhfaatgkplfsshmidlseeslqenieicskylermskigmtleielgctgg
    eedgvdnshmdasalytqpedvdyaytelskisprftiaasfgnvhgvykpgnvvltpti
    lrdsqeyvskkhnlphnslnfvfhggsgstaqeikdsvsygvvkmnidtdtqwatwegvl
    nyykaneaylqgqlgnpkgedqpnkkyydprvwlragqtsmiarlekafqelnaidvl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1b57B (B:)
    skifdfvkpgvitgddvqkvfqvakennfalpavncvgtdsinavletaakvkapvivqf
    snggasfiagkgvksdvpqgaailgaisgahhvhqmaehygvpvilhtdhcakkllpwid
    glldagekhfaatgkplfsshmidlseeslqenieicskylermskigmtleielgctgg
    eelytqpedvdyaytelskisprftiaasfgnvhgvykpgnvvltptilrdsqeyvskkh
    nlphnslnfvfhggsgstaqeikdsvsygvvkmnidtdtqwatwegvlnyykaneaylqg
    qlgnpkgedqpnkkyydprvwlragqtsmiarlekafqelnaidvl