PDB entry 1b56

View 1b56 on RCSB PDB site
Description: human recombinant epidermal fatty acid binding protein
Class: lipid binding protein
Keywords: lipid-binding, fatty acid transport, beta barrel, lipid binding protein
Deposited on 1999-01-12, released 1999-10-05
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.05 Å
R-factor: 0.207
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: fatty acid binding protein
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1b56a_
  • Heterogens: PLM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1b56A (A:)
    matvqqlegrwrlvdskgfdeymkelgvgialrkmgamakpdciitcdgknltiktestl
    kttqfsctlgekfeettadgrktqtvcnftdgalvqhqewdgkestitrklkdgklvvec
    vmnnvtctriyekve
    

    Sequence, based on observed residues (ATOM records): (download)
    >1b56A (A:)
    tvqqlegrwrlvdskgfdeymkelgvgialrkmgamakpdciitcdgknltiktestlkt
    tqfsctlgekfeettadgrktqtvcnftdgalvqhqewdgkestitrklkdgklvvecvm
    nnvtctriyekve