PDB entry 1b55

View 1b55 on RCSB PDB site
Description: ph domain from bruton's tyrosine kinase in complex with inositol 1,3,4,5-tetrakisphosphate
Deposited on 1999-01-12, released 1999-06-15
The last revision prior to the SCOP 1.55 freeze date was dated 1999-06-15, with a file datestamp of 1999-06-14.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.234
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.55: d1b55a_
  • Chain 'B':
    Domains in SCOP 1.55: d1b55b_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1b55A (A:)
    aavilesiflkrsqqkkktsplnfkkrlflltvhklsyyeydfergrrgskkgsidveki
    tcvetvvpeknppperqiprrgeessemeqisiierfpypfqvvydegplyvfspteelr
    krwihqlknvirynsdlvqkyhpcfwidgqylccsqtaknamgcqilen
    

    Sequence, based on observed residues (ATOM records): (download)
    >1b55A (A:)
    aavilesiflkrsqqkkktsplnfkkrlflltvhklsyyeydfergrrgskkgsidveki
    tcvetvvpeknppperqiprrmeqisiierfpypfqvvydegplyvfspteelrkrwihq
    lknvirynsdlvqkyhpcfwidgqylccsqtaknamgcqilen
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1b55B (B:)
    aavilesiflkrsqqkkktsplnfkkrlflltvhklsyyeydfergrrgskkgsidveki
    tcvetvvpeknppperqiprrgeessemeqisiierfpypfqvvydegplyvfspteelr
    krwihqlknvirynsdlvqkyhpcfwidgqylccsqtaknamgcqilen
    

    Sequence, based on observed residues (ATOM records): (download)
    >1b55B (B:)
    aavilesiflkrsqqkkktsplnfkkrlflltvhklsyyeydfergrrgskkgsidveki
    tcvetvvpeknppperqisemeqisiierfpypfqvvydegplyvfspteelrkrwihql
    knvirynsdlvqkyhpcfwidgqylccsqtaknamgcqilen