PDB entry 1b54

View 1b54 on RCSB PDB site
Description: crystal structure of a yeast hypothetical protein-a structure from bnl's human proteome project
Deposited on 1999-01-12, released 1999-01-27
The last revision prior to the SCOP 1.55 freeze date was dated 1999-04-13, with a file datestamp of 1999-04-13.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.235
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.55: d1b54__

PDB Chain Sequences:

  • Chain ' ':
    Sequence, based on SEQRES records: (download)
    >1b54_ (-)
    gitydedrktqliaqyesvrevvnaeaknvhvnenaskilllvvsklkpasdiqilydhg
    vrefgenyvqeliekakllpddikwhfigglqtnkckdlakvpnlysvetidslkkakkl
    nesrakfqpdcnpilcnvqintshedqksglnneaeifevidfflseeckyiklnglmti
    gswnvshedskenrdfatlvewkkkidakfgtslklsmgmsadfreairqgtaevrigtd
    ifg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1b54_ (-)
    gitydedrktqliaqyesvrevvnaeaknvhskilllvvsklkpasdiqilydhgvrefg
    enyvqeliekakllpddikwhfigglqtnkckdlakvpnlysvetidslkkakklnesra
    kfqpdcnpilcnvqintshedqksglnneaeifevidfflseeckyiklnglmtigswen
    rdfatlvewkkkidakfgtslklsmgmsadfreairqgtaevrigtdifg