PDB entry 1b54

View 1b54 on RCSB PDB site
Description: crystal structure of a yeast hypothetical protein-a structure from bnl's human proteome project
Class: hypothetical protein
Keywords: YEAST HYPOTHETICAL PROTEIN, PROTEOME, PYRIDOXAL PHOSPHATE, TIM BARREL, Structural Genomics, PSI, Protein Structure Initiative, New York SGX Research Center for Structural Genomics, NYSGXRC, HYPOTHETICAL PROTEIN
Deposited on 1999-01-12, released 1999-01-27
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.235
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: yeast hypothetical protein
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: SGD: YBL 036C
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1b54a_
  • Heterogens: PLP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1b54A (A:)
    mstgitydedrktqliaqyesvrevvnaeaknvhvnenaskilllvvsklkpasdiqily
    dhgvrefgenyvqeliekakllpddikwhfigglqtnkckdlakvpnlysvetidslkka
    kklnesrakfqpdcnpilcnvqintshedqksglnneaeifevidfflseeckyiklngl
    mtigswnvshedskenrdfatlvewkkkidakfgtslklsmgmsadfreairqgtaevri
    gtdifgarppknearii
    

    Sequence, based on observed residues (ATOM records): (download)
    >1b54A (A:)
    gitydedrktqliaqyesvrevvnaeaknvhskilllvvsklkpasdiqilydhgvrefg
    enyvqeliekakllpddikwhfigglqtnkckdlakvpnlysvetidslkkakklnesra
    kfqpdcnpilcnvqintshedqksglnneaeifevidfflseeckyiklnglmtigswen
    rdfatlvewkkkidakfgtslklsmgmsadfreairqgtaevrigtdifg