PDB entry 1b53

View 1b53 on RCSB PDB site
Description: nmr structure of human mip-1a d26a, minimized average structure
Class: chemokine
Keywords: chemokine, cytokine, chemotaxis
Deposited on 1999-01-11, released 1999-07-22
The last revision prior to the SCOPe 2.08 freeze date was dated 2012-02-22, with a file datestamp of 2012-02-17.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: mip-1a
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P10147 (0-68)
    • engineered (25)
  Domains in SCOPe 2.08: d1b53a_
• Chain 'B':
  Compound: mip-1a
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P10147 (0-68)
    • engineered (25)
  Domains in SCOPe 2.08: d1b53b_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1b53A (A:)
  slaadtptaccfsytsrqipqnfiaayfetssqcskpgvifltkrsrqvcadpseewvqk
  yvsdlelsa
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1b53B (B:)
  slaadtptaccfsytsrqipqnfiaayfetssqcskpgvifltkrsrqvcadpseewvqk
  yvsdlelsa