PDB entry 1b52

View 1b52 on RCSB PDB site
Description: oligo-peptide binding protein (oppa) complexed with ktk
Class: peptide binding protein
Keywords: complex (peptide transport/peptide), peptide transport, peptide binding protein
Deposited on 1999-01-11, released 1999-01-20
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.195
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (oligo-peptide binding protein)
    Species: Salmonella typhimurium [TaxId:602]
    Gene: OPPA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1b52a_
  • Chain 'B':
    Compound: protein (lys-thr-lys)
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • PDB 1B52 (0-2)
  • Heterogens: IUM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1b52A (A:)
    advpagvqladkqtlvrnngsevqsldphkiegvpesnvsrdlfegllisdveghpspgv
    aekwenkdfkvwtfhlrenakwsdgtpvtahdfvyswqrladpntaspyasylqyghian
    iddiiagkkpatdlgvkalddhtfevtlsepvpyfykllvhpsvspvpksavekfgdkwt
    qpanivtngayklknwvvnerivlernpqywdnaktvinqvtylpissevtdvnryrsge
    idmtynnmpielfqklkkeipnevrvdpylctyyyeinnqkapfndvrvrtalklaldrd
    iivnkvknqgdlpaysytppytdgaklvepewfkwsqqkrneeakkllaeagftadkplt
    fdllyntsdlhkklaiavasiwkknlgvnvnlenqewktfldtrhqgtfdvaragwcady
    neptsflntmlsdssnntahykspafdkliadtlkvaddtqrselyakaeqqldkdsaiv
    pvyyyvnarlvkpwvggytgkdpldniyvknlyiikh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1b52A (A:)
    advpagvqladkqtlvrnngsevqsldphkiegvpesnvsrdlfegllisdveghpspgv
    aekwenkdfkvwtfhlrenakwsdgtpvtahdfvyswqrladpntaspyasylqyghian
    iddiiagkkpatdlgvkalddhtfevtlsepvpyfykllvhpsvspvpksavekfgdkwt
    qpanivtngayklknwvvnerivlernpqywdnaktvinqvtylpissevtdvnryrsge
    idmtynnmpielfqklkkeipnevrvdpylctyyyeinnqkapfndvrvrtalklaldrd
    iivnkvknqgdlpaysytppytdgaklvepewfkwsqqkrneeakkllaeagftapltfd
    llyntsdlhkklaiavasiwkknlgvnvnlenqewktfldtrhqgtfdvaragwcadyne
    ptsflntmlsdssnntahykspafdkliadtlkvaddtqrselyakaeqqldkdsaivpv
    yyyvnarlvkpwvggytgkdpldniyvknlyiikh
    

  • Chain 'B':
    No sequence available.