PDB entry 1b50

View 1b50 on RCSB PDB site
Description: nmr structure of human mip-1a d26a, 10 structures
Class: chemokine
Keywords: chemokine, cytokine, chemotaxis
Deposited on 1999-01-11, released 1999-07-22
The last revision prior to the SCOPe 2.07 freeze date was dated 2012-02-22, with a file datestamp of 2012-02-17.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: mip-1a
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P10147 (0-68)
      • engineered (25)
    Domains in SCOPe 2.07: d1b50a_
  • Chain 'B':
    Compound: mip-1a
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P10147 (0-68)
      • engineered (25)
    Domains in SCOPe 2.07: d1b50b_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1b50A (A:)
    slaadtptaccfsytsrqipqnfiaayfetssqcskpgvifltkrsrqvcadpseewvqk
    yvsdlelsa
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1b50B (B:)
    slaadtptaccfsytsrqipqnfiaayfetssqcskpgvifltkrsrqvcadpseewvqk
    yvsdlelsa