PDB entry 1b50

View 1b50 on RCSB PDB site
Description: nmr structure of human mip-1a d26a, 10 structures
Deposited on 1999-01-11, released 1999-07-22
The last revision prior to the SCOP 1.69 freeze date was dated 1999-07-22, with a file datestamp of 1999-07-21.
Experiment type: NMR10
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.69: d1b50a_
  • Chain 'B':
    Domains in SCOP 1.69: d1b50b_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1b50A (A:)
    slaadtptaccfsytsrqipqnfiaayfetssqcskpgvifltkrsrqvcadpseewvqk
    yvsdlelsa
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1b50B (B:)
    slaadtptaccfsytsrqipqnfiaayfetssqcskpgvifltkrsrqvcadpseewvqk
    yvsdlelsa