PDB entry 1b4w

View 1b4w on RCSB PDB site
Description: basic phospholipase a2 from agkistrodon halys pallas-implications for its association and anticoagulant activities by x-ray crystallography
Class: hydrolase
Keywords: basic phospholipase a2, agkistrodon halys pallas, dimer, anticoagulant activity, hydrolase
Deposited on 1998-12-30, released 2000-01-12
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.205
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (phospholipase a2)
    Species: Gloydius halys [TaxId:8714]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O42187 (0-121)
      • engineered (0)
      • engineered (53)
      • engineered (108)
      • see remark 999 (111)
    Domains in SCOPe 2.07: d1b4wa_
  • Chain 'B':
    Compound: protein (phospholipase a2)
    Species: Gloydius halys [TaxId:8714]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O42187 (0-121)
      • engineered (0)
      • engineered (53)
      • engineered (108)
      • see remark 999 (111)
    Domains in SCOPe 2.07: d1b4wb_
  • Chain 'C':
    Compound: protein (phospholipase a2)
    Species: Gloydius halys [TaxId:8714]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O42187 (0-121)
      • engineered (0)
      • engineered (53)
      • engineered (108)
      • see remark 999 (111)
    Domains in SCOPe 2.07: d1b4wc_
  • Chain 'D':
    Compound: protein (phospholipase a2)
    Species: Gloydius halys [TaxId:8714]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O42187 (0-121)
      • engineered (0)
      • engineered (53)
      • engineered (108)
      • see remark 999 (111)
    Domains in SCOPe 2.07: d1b4wd_
  • Heterogens: BOG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1b4wA (A:)
    hllqfrkmikkmtgkepvvsyafygcycgsggrgkpkdatdrccfvhdccyekvtgcdpk
    wddytyswkngtivcggddpckkevcecdkaaaicfrdnlktykkrymaypdilcsskse
    kc
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1b4wB (B:)
    hllqfrkmikkmtgkepvvsyafygcycgsggrgkpkdatdrccfvhdccyekvtgcdpk
    wddytyswkngtivcggddpckkevcecdkaaaicfrdnlktykkrymaypdilcsskse
    kc
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1b4wC (C:)
    hllqfrkmikkmtgkepvvsyafygcycgsggrgkpkdatdrccfvhdccyekvtgcdpk
    wddytyswkngtivcggddpckkevcecdkaaaicfrdnlktykkrymaypdilcsskse
    kc
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1b4wD (D:)
    hllqfrkmikkmtgkepvvsyafygcycgsggrgkpkdatdrccfvhdccyekvtgcdpk
    wddytyswkngtivcggddpckkevcecdkaaaicfrdnlktykkrymaypdilcsskse
    kc