PDB entry 1b4s

View 1b4s on RCSB PDB site
Description: structure of nucleoside diphosphate kinase h122g mutant
Class: phosphotransferase
Keywords: transferase, kinase, ATP-binding, phosphotransferase
Deposited on 1998-12-28, released 1999-06-15
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.203
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Nucleoside diphosphate kinase
    Species: Dictyostelium discoideum [TaxId:44689]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P22887 (Start-154)
      • engineered (121)
    Domains in SCOPe 2.07: d1b4sa_
  • Chain 'B':
    Compound: Nucleoside diphosphate kinase
    Species: Dictyostelium discoideum [TaxId:44689]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P22887 (Start-154)
      • engineered (121)
    Domains in SCOPe 2.07: d1b4sb_
  • Chain 'C':
    Compound: Nucleoside diphosphate kinase
    Species: Dictyostelium discoideum [TaxId:44689]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P22887 (Start-154)
      • engineered (121)
    Domains in SCOPe 2.07: d1b4sc_
  • Heterogens: PO4, MG, ADP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1b4sA (A:)
    mstnkvnkertflavkpdgvarglvgeiiaryekkgfvlvglkqlvptkdlaeshyaehk
    erpffgglvsfitsgpvvamvfegkgvvasarlmigvtnplasapgsirgdfgvdvgrni
    iggsdsvesanreialwfkpeelltevkpnpnlye
    

    Sequence, based on observed residues (ATOM records): (download)
    >1b4sA (A:)
    vnkertflavkpdgvarglvgeiiaryekkgfvlvglkqlvptkdlaeshyaehkerpff
    gglvsfitsgpvvamvfegkgvvasarlmigvtnplasapgsirgdfgvdvgrniiggsd
    svesanreialwfkpeelltevkpnpnlye
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1b4sB (B:)
    mstnkvnkertflavkpdgvarglvgeiiaryekkgfvlvglkqlvptkdlaeshyaehk
    erpffgglvsfitsgpvvamvfegkgvvasarlmigvtnplasapgsirgdfgvdvgrni
    iggsdsvesanreialwfkpeelltevkpnpnlye
    

    Sequence, based on observed residues (ATOM records): (download)
    >1b4sB (B:)
    vnkertflavkpdgvarglvgeiiaryekkgfvlvglkqlvptkdlaeshyaehkerpff
    gglvsfitsgpvvamvfegkgvvasarlmigvtnplasapgsirgdfgvdvgrniiggsd
    svesanreialwfkpeelltevkpnpnlye
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1b4sC (C:)
    mstnkvnkertflavkpdgvarglvgeiiaryekkgfvlvglkqlvptkdlaeshyaehk
    erpffgglvsfitsgpvvamvfegkgvvasarlmigvtnplasapgsirgdfgvdvgrni
    iggsdsvesanreialwfkpeelltevkpnpnlye
    

    Sequence, based on observed residues (ATOM records): (download)
    >1b4sC (C:)
    vnkertflavkpdgvarglvgeiiaryekkgfvlvglkqlvptkdlaeshyaehkerpff
    gglvsfitsgpvvamvfegkgvvasarlmigvtnplasapgsirgdfgvdvgrniiggsd
    svesanreialwfkpeelltevkpnpnlye