PDB entry 1b4r

View 1b4r on RCSB PDB site
Description: pkd domain 1 from human polycystein-1
Class: membrane protein
Keywords: pkd domain 1 from human polycystein-1, polycystin (precursor), membrane protein
Deposited on 1998-12-28, released 1999-01-06
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: protein (pkd1_human)
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P98161 (0-79)
    • conflict (20)
  Domains in SCOPe 2.08: d1b4ra_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1b4rA (A:)
  atlvgphgplasgqlaafhiaaplpvtatrwdfgdgsaevdaagpaashryvlpgryhvt
  avlalgagsallgtdvqvea