PDB entry 1b4q

View 1b4q on RCSB PDB site
Description: solution structure of human thioltransferase complex with glutathione
Deposited on 1998-12-25, released 1999-12-23
The last revision prior to the SCOP 1.57 freeze date was dated 1999-12-23, with a file datestamp of 1999-12-22.
Experiment type: NMR21
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.08 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Domains in SCOP 1.57: d1b4qa_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1b4qA (A:)
  aqefvnskiqpgkvvvfikptcpysrraqeilsqlpikqgllefvditatnhtneiqdyl
  qqltgartvprvfigkdsiggssdlvslqqsgelltrlkqigalq