PDB entry 1b4o

View 1b4o on RCSB PDB site
Description: nmr study of sso7d mutant (f31a) minimized average structure
Class: DNA-binding protein
Keywords: RNAse and DNA-binding protein, thermostable ribonuclease, 3d-structure, nmr, sulfolobus solfataricus
Deposited on 1998-12-24, released 2000-01-05
The last revision prior to the SCOP 1.75 freeze date was dated 2003-04-01, with a file datestamp of 2007-06-04.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.16 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: endoribonuclease p2
    Species: Sulfolobus solfataricus
    Database cross-references and differences (RAF-indexed):
    • Uniprot P61991 (0-61)
      • conflict (30)
    Domains in SCOP 1.75: d1b4oa_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1b4oA (A:)
    atvkfkykgeekqvdiskikkvwrvgkmisatydegggktgrgavsekdapkellqmlek
    qk