PDB entry 1b4o

View 1b4o on RCSB PDB site
Description: nmr study of sso7d mutant (f31a) minimized average structure
Deposited on 1998-12-24, released 2000-01-05
The last revision prior to the SCOP 1.57 freeze date was dated 2000-01-05, with a file datestamp of 2000-01-04.
Experiment type: NMRAVE
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.57: d1b4o__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1b4o_ (-)
    atvkfkykgeekqvdiskikkvwrvgkmisatydegggktgrgavsekdapkellqmlek
    qk