PDB entry 1b4l

View 1b4l on RCSB PDB site
Description: 15 atmosphere oxygen yeast cu/zn superoxide dismutase room temperature (298k) structure
Class: oxidoreductase
Keywords: superoxide acceptor, copper, zinc, oxidoreductase
Deposited on 1998-12-22, released 1999-12-23
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.2
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: protein (cu/zn superoxide dismutase)
  Species: Saccharomyces cerevisiae [TaxId:4932]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P00445 (0-152)
  Domains in SCOPe 2.08: d1b4la_
• Heterogens: CU, ZN, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1b4lA (A:)
  vqavavlkgdagvsgvvkfeqasesepttvsyeiagnspnaergfhihefgdatngcvsa
  gphfnpfkkthgaptdevrhvgdmgnvktdengvakgsfkdslikligptsvvgrsvvih
  agqddlgkgdteeslktgnagprpacgvigltn