PDB entry 1b4k

View 1b4k on RCSB PDB site
Description: High resolution crystal structure of a MG2-dependent 5-aminolevulinic acid dehydratase
Deposited on 1998-12-22, released 1999-07-12
The last revision prior to the SCOP 1.71 freeze date was dated 1999-07-12, with a file datestamp of 1999-07-11.
Experiment type: XRAY
Resolution: 1.67 Å
R-factor: 0.178
AEROSPACI score: 0.57 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.71: d1b4ka_
  • Chain 'B':
    Domains in SCOP 1.71: d1b4kb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1b4kA (A:)
    msftpanraypytrlrrnrrddfsrrlvrenvltvddlilpvfvldgvnqresipsmpgv
    erlsidqllieaeewvalgipalalfpvtpvekksldaaeaynpegiaqratralrerfp
    elgiitdvaldpftthgqdgildddgyvlndvsidvlvrqalshaeagaqvvapsdmmdg
    rigairealesaghtnvrimaysakyasayygpfrdavgsasnlgkgnkatyqmdpansd
    ealhevaadlaegadmvmvkpgmpyldivrrvkdefraptfvyqvsgeyamhmgaiqngw
    laesvilesltafkragadgiltyfakqaaeqlrrgr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1b4kA (A:)
    ypytrlrrnrrddfsrrlvrenvltvddlilpvfvldgvnqresipsmpgverlsidqll
    ieaeewvalgipalalfpvtpvekksldaaeaynpegiaqratralrerfpelgiitdva
    ldpftthgqdgildddgyvlndvsidvlvrqalshaeagaqvvapsdmmdgrigaireal
    esaghtnvrimaysakyasayygpfrdavgsasnlgkgnkatyqmdpansdealhevaad
    laegadmvmvkpgmpyldivrrvkdefraptfvyqvsgeyamhmgaiqngwlaesviles
    ltafkragadgiltyfakqaaeqlrr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1b4kB (B:)
    msftpanraypytrlrrnrrddfsrrlvrenvltvddlilpvfvldgvnqresipsmpgv
    erlsidqllieaeewvalgipalalfpvtpvekksldaaeaynpegiaqratralrerfp
    elgiitdvaldpftthgqdgildddgyvlndvsidvlvrqalshaeagaqvvapsdmmdg
    rigairealesaghtnvrimaysakyasayygpfrdavgsasnlgkgnkatyqmdpansd
    ealhevaadlaegadmvmvkpgmpyldivrrvkdefraptfvyqvsgeyamhmgaiqngw
    laesvilesltafkragadgiltyfakqaaeqlrrgr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1b4kB (B:)
    anraypytrlrrnrrddfsrrlvrenvltvddlilpvfvldgvnqresipsmpgverlsi
    dqllieaeewvalgipalalfpvtpvekksldaaeaynpegiaqratralrerfpelgii
    tdvaldpftthgqdgildddgyvlndvsidvlvrqalshaeagaqvvapsdmmdgrigai
    realesaghtnvrimaysakyasayygpfrdavgstyqmdpansdealhevaadlaegad
    mvmvkpgmpyldivrrvkdefraptfvyqvsgeyamhmgaiqngwlaesvilesltafkr
    agadgiltyfakqaaeqlrr