PDB entry 1b4j

View 1b4j on RCSB PDB site
Description:
Deposited on 1998-12-22, released 1999-06-15
The last revision prior to the SCOP 1.65 freeze date was dated 1999-06-15, with a file datestamp of 1999-06-14.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: 0.193
AEROSPACI score: -1.78 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.65: d1b4jh1, d1b4jh2
  • Chain 'L':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.65: d1b4jl1, d1b4jl2

PDB Chain Sequences:

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1b4jH (H:)
    evqlqqpgadlvmpgapvklsclasgyiftsswinwvkqrpgrglewigridpsdgevhy
    nqdfkdkatltvdkssstayiqlnsltsedsavyycargflpwfadwgqgtlvtvsaast
    kgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqssgly
    slssvvtvpssslgtqtyicnvnhkpsntkvdkkvepksc
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1b4jL (L:)
    nivmtqspksmyvsigervtlsckasenvdtyvswyqqkpeqspklliygasnrytgvpd
    rftgsgsatdftltissvqaedladyhcgqsynypftfgsgtkleikrtvaapsvfifpp
    sdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstlt
    lskadyekhkvyacevthqglsspvtksfnrgec