PDB entry 1b4j

View 1b4j on RCSB PDB site
Description: comparison of the three-dimensional structures of a humanized and a chimeric fab of an anti-gamma-interferon antibody
Class: antibody engineering
Keywords: antibody engineering, humanized and chimeric antibodies, fab, x-ray structures, gamma-interferon
Deposited on 1998-12-22, released 1999-06-15
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: 0.193
AEROSPACI score: -1.78 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound: antibody
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 1B4J (0-219)
    Domains in SCOPe 2.07: d1b4jh1, d1b4jh2
  • Chain 'L':
    Compound: antibody
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • EMBL CAA65061 (2-213)
      • conflict (8)
      • conflict (10-14)
      • conflict (16)
      • conflict (20-21)
      • conflict (23)
      • conflict (26-30)
      • conflict (32-33)
      • conflict (40-42)
      • conflict (49)
      • conflict (52-55)
      • conflict (59)
      • conflict (62)
      • conflict (67)
      • conflict (77)
      • conflict (79)
      • conflict (82)
      • conflict (84)
      • conflict (86)
      • conflict (88)
      • conflict (91-93)
      • conflict (95)
      • conflict (99)
      • conflict (102)
    Domains in SCOPe 2.07: d1b4jl1, d1b4jl2

PDB Chain Sequences:

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1b4jH (H:)
    evqlqqpgadlvmpgapvklsclasgyiftsswinwvkqrpgrglewigridpsdgevhy
    nqdfkdkatltvdkssstayiqlnsltsedsavyycargflpwfadwgqgtlvtvsaast
    kgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqssgly
    slssvvtvpssslgtqtyicnvnhkpsntkvdkkvepksc
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1b4jL (L:)
    nivmtqspksmyvsigervtlsckasenvdtyvswyqqkpeqspklliygasnrytgvpd
    rftgsgsatdftltissvqaedladyhcgqsynypftfgsgtkleikrtvaapsvfifpp
    sdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstlt
    lskadyekhkvyacevthqglsspvtksfnrgec