PDB entry 1b4i

View 1b4i on RCSB PDB site
Description: Control of K+ Channel Gating by protein phosphorylation: structural switches of the inactivation gate, NMR, 22 structures
Class: proton transport
Keywords: potassium channel, inactivation gate, phosphorylation, proton transport
Deposited on 1998-12-22, released 1999-04-27
The last revision prior to the SCOPe 2.08 freeze date was dated 2010-05-19, with a file datestamp of 2010-05-14.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: -0.01 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: potassium channel
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q03721 (0-29)
  Domains in SCOPe 2.08: d1b4ia_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1b4iA (A:)
  missvcvssyrgrksgnkppsktclkeema