PDB entry 1b4g

View 1b4g on RCSB PDB site
Description: control of k+ channel gating by protein phosphorylation: structural switches of the inactivation gate, nmr, 22 structures
Class: potassium channel
Keywords: potassium channel, inactivation gate, phosphorylation
Deposited on 1998-12-22, released 1999-04-27
The last revision prior to the SCOPe 2.08 freeze date was dated 2010-05-19, with a file datestamp of 2010-05-14.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: -0 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: potassium channel
  Species: HOMO SAPIENS, synthetic [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q03721 (0-29)
  Domains in SCOPe 2.08: d1b4ga_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1b4gA (A:)
  missvcvssyrgrksgnkppsktclkeema