PDB entry 1b4f

View 1b4f on RCSB PDB site
Description: oligomeric structure of the human ephb2 receptor sam domain
Class: signal transduction
Keywords: sam domain, eph receptor, signal transduction, oligomer
Deposited on 1998-12-20, released 1999-02-16
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: 0.228
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ephb2
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1b4fa_
  • Chain 'B':
    Compound: ephb2
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P29323 (3-End)
      • conflict (4)
    Domains in SCOPe 2.07: d1b4fb_
  • Chain 'C':
    Compound: ephb2
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1b4fc_
  • Chain 'D':
    Compound: ephb2
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1b4fd_
  • Chain 'E':
    Compound: ephb2
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1b4fe_
  • Chain 'F':
    Compound: ephb2
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1b4ff_
  • Chain 'G':
    Compound: ephb2
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1b4fg_
  • Chain 'H':
    Compound: ephb2
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1b4fh_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1b4fA (A:)
    mektrpdytsfntvdewleaikmgqykesfanagftsfdvvsqmmmedilrvgvtlaghq
    kkilnsiqvmraqmnqiqsvev
    

    Sequence, based on observed residues (ATOM records): (download)
    >1b4fA (A:)
    pdytsfntvdewleaikmgqykesfanagftsfdvvsqmmmedilrvgvtlaghqkkiln
    siqvmraqmnqiqs
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1b4fB (B:)
    mektrpdytsfntvdewleaikmgqykesfanagftsfdvvsqmmmedilrvgvtlaghq
    kkilnsiqvmraqmnqiqsvev
    

    Sequence, based on observed residues (ATOM records): (download)
    >1b4fB (B:)
    trpdytsfntvdewleaikmgqykesfanagftsfdvvsqmmmedilrvgvtlaghqkki
    lnsiqvmraqmnqiqsv
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1b4fC (C:)
    mektrpdytsfntvdewleaikmgqykesfanagftsfdvvsqmmmedilrvgvtlaghq
    kkilnsiqvmraqmnqiqsvev
    

    Sequence, based on observed residues (ATOM records): (download)
    >1b4fC (C:)
    pdytsfntvdewleaikmgqykesfanagftsfdvvsqmmmedilrvgvtlaghqkkiln
    siqvmraqmnqiqs
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1b4fD (D:)
    mektrpdytsfntvdewleaikmgqykesfanagftsfdvvsqmmmedilrvgvtlaghq
    kkilnsiqvmraqmnqiqsvev
    

    Sequence, based on observed residues (ATOM records): (download)
    >1b4fD (D:)
    rpdytsfntvdewleaikmgqykesfanagftsfdvvsqmmmedilrvgvtlaghqkkil
    nsiqvmraqmnqiqs
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1b4fE (E:)
    mektrpdytsfntvdewleaikmgqykesfanagftsfdvvsqmmmedilrvgvtlaghq
    kkilnsiqvmraqmnqiqsvev
    

    Sequence, based on observed residues (ATOM records): (download)
    >1b4fE (E:)
    pdytsfntvdewleaikmgqykesfanagftsfdvvsqmmmedilrvgvtlaghqkkiln
    siqvmraqmnqiqs
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1b4fF (F:)
    mektrpdytsfntvdewleaikmgqykesfanagftsfdvvsqmmmedilrvgvtlaghq
    kkilnsiqvmraqmnqiqsvev
    

    Sequence, based on observed residues (ATOM records): (download)
    >1b4fF (F:)
    rpdytsfntvdewleaikmgqykesfanagftsfdvvsqmmmedilrvgvtlaghqkkil
    nsiqvmraqmnqiqsve
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >1b4fG (G:)
    mektrpdytsfntvdewleaikmgqykesfanagftsfdvvsqmmmedilrvgvtlaghq
    kkilnsiqvmraqmnqiqsvev
    

    Sequence, based on observed residues (ATOM records): (download)
    >1b4fG (G:)
    pdytsfntvdewleaikmgqykesfanagftsfdvvsqmmmedilrvgvtlaghqkkiln
    siqvmraqmnqi
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >1b4fH (H:)
    mektrpdytsfntvdewleaikmgqykesfanagftsfdvvsqmmmedilrvgvtlaghq
    kkilnsiqvmraqmnqiqsvev
    

    Sequence, based on observed residues (ATOM records): (download)
    >1b4fH (H:)
    rpdytsfntvdewleaikmgqykesfanagftsfdvvsqmmmedilrvgvtlaghqkkil
    nsiqvmraqmnqiqsv