PDB entry 1b4d

View 1b4d on RCSB PDB site
Description: amidocarbamate inhibitor of glycogen phosphorylase
Class: transferase
Keywords: glycogen phosphorylase, inhibitor binding, amidocarbamate, transferase
Deposited on 1998-12-18, released 1998-12-23
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.182
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (glycogen phosphorylase b)
    Species: Oryctolagus cuniculus [TaxId:9986]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00489
      • see remark 999 (379)
      • see remark 999 (608)
    Domains in SCOPe 2.07: d1b4da_
  • Heterogens: CRA, PLP, IMP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1b4dA (A:)
    srplsdqekrkqisvrglagvenvtelkknfnrhlhftlvkdrnvatprdyyfalahtvr
    dhlvgrwirtqqhyyekdpkriyylslefymgrtlqntmvnlalenacdeatyqlgldme
    eleeieedaglgngglgrlaacfldsmatlglaaygygiryefgifnqkicggwqmeead
    dwlrygnpwekarpeftlpvhfygrvehtsqgakwvdtqvvlampydtpvpgyrnnvvnt
    mrlwsakapndfnlkdfnvggyiqavldrnlaenisrvlypndnffegkelrlkqeyfvv
    aatlqdiirrfksskfgcrdpvrtnfdafpdkvaiqlndthpslaipelmrvlvdlerld
    wdkawevtvktcaytnhtvipealerwpvhlletllprhlqiiyeinqrflnrvaaafpg
    dvdrlrrmslveegavkrinmahlciagshavngvarihseilkktifkdfyelephkfq
    nktngitprrwlvlcnpglaeiiaerigeeyisdldqlrkllsyvddeafirdvakvkqe
    nklkfaaylereykvhinpnslfdvqvkriheykrqllnclhvitlynrikkepnkfvvp
    rtvmiggkaapgyhmakmiiklitaigdvvnhdpvvgdrlrviflenyrvslaekvipaa
    dlseqistagteasgtgnmkfmlngaltigtmdganvemaeeageenffifgmrvedvdr
    ldqrgynaqeyydripelrqiieqlssgffspkqpdlfkdivnmlmhhdrfkvfadyeey
    vkcqervsalyknprewtrmvirniatsgkfssdrtiaqyareiwgvepsrqrlpapdek
    ip
    

    Sequence, based on observed residues (ATOM records): (download)
    >1b4dA (A:)
    isvrglagvenvtelkknfnrhlhftlvkdrnvatprdyyfalahtvrdhlvgrwirtqq
    hyyekdpkriyylslefymgrtlqntmvnlalenacdeatyqlgldmeeleeieedaglg
    ngglgrlaacfldsmatlglaaygygiryefgifnqkicggwqmeeaddwlrygnpweka
    rpeftlpvhfygrvehtsqgakwvdtqvvlampydtpvpgyrnnvvntmrlwsakapngy
    iqavldrnlaenisrvlypndnffegkelrlkqeyfvvaatlqdiirrfkssknfdafpd
    kvaiqlndthpslaipelmrvlvdlerldwdkawevtvktcaytnhtvipealerwpvhl
    letllprhlqiiyeinqrflnrvaaafpgdvdrlrrmslveegavkrinmahlciagsha
    vngvarihseilkktifkdfyelephkfqnktngitprrwlvlcnpglaeiiaerigeey
    isdldqlrkllsyvddeafirdvakvkqenklkfaaylereykvhinpnslfdvqvkrih
    eykrqllnclhvitlynrikkepnkfvvprtvmiggkaapgyhmakmiiklitaigdvvn
    hdpvvgdrlrviflenyrvslaekvipaadlseqistagteasgtgnmkfmlngaltigt
    mdganvemaeeageenffifgmrvedvdrldqrgynaqeyydripelrqiieqlssgffs
    pkqpdlfkdivnmlmhhdrfkvfadyeeyvkcqervsalyknprewtrmvirniatsgkf
    ssdrtiaqyareiwgvepsrqrlp