PDB entry 1b4c

View 1b4c on RCSB PDB site
Description: solution structure of rat apo-s100b using dipolar couplings
Class: metal binding protein
Keywords: s100beta, s100b, nmr, dipolar couplings, ef-hand, s100 protein, calcium- binding protein, four-helix bundle, three-dimensional structure, solution structure, metal binding protein
Deposited on 1998-12-17, released 1998-12-30
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (s-100 protein, beta chain)
    Species: Rattus norvegicus [TaxId:10116]
    Gene: S100BETA FROM RATTUS NORVEGICUS (RAT)
    Database cross-references and differences (RAF-indexed):
    • Uniprot P04631 (1-91)
      • see remark 999 (0)
    Domains in SCOPe 2.07: d1b4ca_
  • Chain 'B':
    Compound: protein (s-100 protein, beta chain)
    Species: Rattus norvegicus [TaxId:10116]
    Gene: S100BETA FROM RATTUS NORVEGICUS (RAT)
    Database cross-references and differences (RAF-indexed):
    • Uniprot P04631 (1-91)
      • see remark 999 (0)
    Domains in SCOPe 2.07: d1b4cb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1b4cA (A:)
    mselekamvalidvfhqysgregdkhklkkselkelinnelshfleeikeqevvdkvmet
    ldedgdgecdfqefmafvsmvttacheffehe
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1b4cB (B:)
    mselekamvalidvfhqysgregdkhklkkselkelinnelshfleeikeqevvdkvmet
    ldedgdgecdfqefmafvsmvttacheffehe