PDB entry 1b4a

View 1b4a on RCSB PDB site
Description: structure of the arginine repressor from bacillus stearothermophilus
Class: repressor
Keywords: repressor, arginine, helix turn helix
Deposited on 1998-12-18, released 1999-06-15
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-11-16, with a file datestamp of 2011-11-11.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.224
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Arginine repressor
    Species: Geobacillus stearothermophilus [TaxId:1422]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1b4aa1, d1b4aa2
  • Chain 'B':
    Compound: Arginine repressor
    Species: Geobacillus stearothermophilus [TaxId:1422]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1b4ab1, d1b4ab2
  • Chain 'C':
    Compound: Arginine repressor
    Species: Geobacillus stearothermophilus [TaxId:1422]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1b4ac1, d1b4ac2
  • Chain 'D':
    Compound: Arginine repressor
    Species: Geobacillus stearothermophilus [TaxId:1422]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1b4ad1, d1b4ad2
  • Chain 'E':
    Compound: Arginine repressor
    Species: Geobacillus stearothermophilus [TaxId:1422]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1b4ae1, d1b4ae2
  • Chain 'F':
    Compound: Arginine repressor
    Species: Geobacillus stearothermophilus [TaxId:1422]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1b4af1, d1b4af2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1b4aA (A:)
    lnkgqrhikireiimsndietqdelvdrlreagfnvtqatvsrdikemqlvkvpmangry
    kyslpsdqrfnplqklkralvdvfikldgtgnllvlrtlpgnahaigvlldnldwdeivg
    ticgddtcliicrtpkdakkvsnqllsml
    

    Sequence, based on observed residues (ATOM records): (download)
    >1b4aA (A:)
    gqrhikireiimsndietqdelvdrlreagfnvtqatvsrdikemqlvkvpmangrykys
    lpsdqrfnplqklkralvdvfikldgtgnllvlrtlpgnahaigvlldnldwdeivgtic
    gddtcliicrtpkdakkvsnqllsml
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1b4aB (B:)
    lnkgqrhikireiimsndietqdelvdrlreagfnvtqatvsrdikemqlvkvpmangry
    kyslpsdqrfnplqklkralvdvfikldgtgnllvlrtlpgnahaigvlldnldwdeivg
    ticgddtcliicrtpkdakkvsnqllsml
    

    Sequence, based on observed residues (ATOM records): (download)
    >1b4aB (B:)
    gqrhikireiimsndietqdelvdrlreagfnvtqatvsrdikemqlvkvpmangrykys
    lpsdqrfnplqklkralvdvfikldgtgnllvlrtlpgnahaigvlldnldwdeivgtic
    gddtcliicrtpkdakkvsnqllsml
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1b4aC (C:)
    lnkgqrhikireiimsndietqdelvdrlreagfnvtqatvsrdikemqlvkvpmangry
    kyslpsdqrfnplqklkralvdvfikldgtgnllvlrtlpgnahaigvlldnldwdeivg
    ticgddtcliicrtpkdakkvsnqllsml
    

    Sequence, based on observed residues (ATOM records): (download)
    >1b4aC (C:)
    gqrhikireiimsndietqdelvdrlreagfnvtqatvsrdikemqlvkvpmangrykys
    lpsdqrfnplqklkralvdvfikldgtgnllvlrtlpgnahaigvlldnldwdeivgtic
    gddtcliicrtpkdakkvsnqllsml
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1b4aD (D:)
    lnkgqrhikireiimsndietqdelvdrlreagfnvtqatvsrdikemqlvkvpmangry
    kyslpsdqrfnplqklkralvdvfikldgtgnllvlrtlpgnahaigvlldnldwdeivg
    ticgddtcliicrtpkdakkvsnqllsml
    

    Sequence, based on observed residues (ATOM records): (download)
    >1b4aD (D:)
    gqrhikireiimsndietqdelvdrlreagfnvtqatvsrdikemqlvkvpmangrykys
    lpsdqrfnplqklkralvdvfikldgtgnllvlrtlpgnahaigvlldnldwdeivgtic
    gddtcliicrtpkdakkvsnqllsml
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1b4aE (E:)
    lnkgqrhikireiimsndietqdelvdrlreagfnvtqatvsrdikemqlvkvpmangry
    kyslpsdqrfnplqklkralvdvfikldgtgnllvlrtlpgnahaigvlldnldwdeivg
    ticgddtcliicrtpkdakkvsnqllsml
    

    Sequence, based on observed residues (ATOM records): (download)
    >1b4aE (E:)
    gqrhikireiimsndietqdelvdrlreagfnvtqatvsrdikemqlvkvpmangrykys
    lpsdqrfnplqklkralvdvfikldgtgnllvlrtlpgnahaigvlldnldwdeivgtic
    gddtcliicrtpkdakkvsnqllsml
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1b4aF (F:)
    lnkgqrhikireiimsndietqdelvdrlreagfnvtqatvsrdikemqlvkvpmangry
    kyslpsdqrfnplqklkralvdvfikldgtgnllvlrtlpgnahaigvlldnldwdeivg
    ticgddtcliicrtpkdakkvsnqllsml
    

    Sequence, based on observed residues (ATOM records): (download)
    >1b4aF (F:)
    gqrhikireiimsndietqdelvdrlreagfnvtqatvsrdikemqlvkvpmangrykys
    lpsdqrfnplqklkralvdvfikldgtgnllvlrtlpgnahaigvlldnldwdeivgtic
    gddtcliicrtpkdakkvsnqllsml