PDB entry 1b49

View 1b49 on RCSB PDB site
Description: dcmp hydroxymethylase from t4 (phosphate-bound)
Class: transferase
Keywords: hydroxymethylase, dNTP synthesizing complex, transferase
Deposited on 1999-01-06, released 1999-01-13
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-04, with a file datestamp of 2017-09-29.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: N/A
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (deoxycytidylate hydroxymethylase)
    Species: Enterobacteria phage T4 [TaxId:10665]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1b49a_
  • Chain 'C':
    Compound: protein (deoxycytidylate hydroxymethylase)
    Species: Enterobacteria phage T4 [TaxId:10665]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1b49c_
  • Heterogens: PO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1b49A (A:)
    misdsmtveeirlhlglalkekdfvvdktgvktieiigasfvadepfifgalndeyiqre
    lewykskslfvkdipgetpkiwqqvasskgeinsnygwaiwsednyaqydmclaelgqnp
    dsrrgimiytrpsmqfdynkdgmsdfmctntvqylirdkkinavvnmrsndvvfgfrndy
    awqkyvldklvsdlnagdstrqykagsiiwnvgslhvysrhfylvdhwwktgethiskkd
    yvgkya
    

    Sequence, based on observed residues (ATOM records): (download)
    >1b49A (A:)
    misdsmtveeirlhlglalkekdfvvdktgvktieiigasfvadepfifgalndeyiqre
    lewykskslfvkdipgetpkiwqqvasskgeinsnygwaiwsednyaqydmclaelgqnp
    dsrrgimiytrpsmqfdynkdgmsdfmctntvqylirdkkinavvnmrsndvvfgfrndy
    awqkyvldklvsdlnagdstrqykagsiiwnvgslhvysrhfylvdhwwktgethiskkd
    y
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1b49C (C:)
    misdsmtveeirlhlglalkekdfvvdktgvktieiigasfvadepfifgalndeyiqre
    lewykskslfvkdipgetpkiwqqvasskgeinsnygwaiwsednyaqydmclaelgqnp
    dsrrgimiytrpsmqfdynkdgmsdfmctntvqylirdkkinavvnmrsndvvfgfrndy
    awqkyvldklvsdlnagdstrqykagsiiwnvgslhvysrhfylvdhwwktgethiskkd
    yvgkya
    

    Sequence, based on observed residues (ATOM records): (download)
    >1b49C (C:)
    misdsmtveeirlhlglalkekdfvvdktgvktieiigasfvadepfifgalndeyiqre
    lewykskslfvkdipgetpkiwqqvasskgeinsnygwaiwsednyaqydmclaelgqnp
    dsrrgimiytrpsmqfdynkdgmsdfmctntvqylirdkkinavvnmrsndvvfgfrndy
    awqkyvldklvsdlnagdstrqykagsiiwnvgslhvysrhfylvdhwwktgethiskkd
    y