PDB entry 1b47

View 1b47 on RCSB PDB site
Description: structure of the n-terminal domain of cbl in complex with its binding site in zap-70
Deposited on 1999-01-06, released 1999-04-27
The last revision prior to the SCOP 1.59 freeze date was dated 1999-04-27, with a file datestamp of 1999-04-26.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.218
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1b47A (A:)
    ppgtvdkkmvekcwklmdkvvrlcqnpklalknsppyildllpdtyqhlrtilsryegkm
    etlgeneyfrvfmenlmkktkqtislfkegkermyeensqprrnltklslifshmlaelk
    gifpsglfqgdtfritkadaaefwrkafgektivpwksfrqalhevhpissgleamalks
    tidltcndyisvfefdiftrlfqpwssllrnwnslavthpgymafltydevkarlqkfih
    kpgsyifrlsctrlgqwaigyvtadgnilqtiphnkplfqalidgfregfylfpdgrnqn
    pdlt
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1b47B (B:)
    ppgtvdkkmvekcwklmdkvvrlcqnpklalknsppyildllpdtyqhlrtilsryegkm
    etlgeneyfrvfmenlmkktkqtislfkegkermyeensqprrnltklslifshmlaelk
    gifpsglfqgdtfritkadaaefwrkafgektivpwksfrqalhevhpissgleamalks
    tidltcndyisvfefdiftrlfqpwssllrnwnslavthpgymafltydevkarlqkfih
    kpgsyifrlsctrlgqwaigyvtadgnilqtiphnkplfqalidgfregfylfpdgrnqn
    pdlt
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1b47C (C:)
    ppgtvdkkmvekcwklmdkvvrlcqnpklalknsppyildllpdtyqhlrtilsryegkm
    etlgeneyfrvfmenlmkktkqtislfkegkermyeensqprrnltklslifshmlaelk
    gifpsglfqgdtfritkadaaefwrkafgektivpwksfrqalhevhpissgleamalks
    tidltcndyisvfefdiftrlfqpwssllrnwnslavthpgymafltydevkarlqkfih
    kpgsyifrlsctrlgqwaigyvtadgnilqtiphnkplfqalidgfregfylfpdgrnqn
    pdlt