PDB entry 1b44

View 1b44 on RCSB PDB site
Description: crystal structure of the b subunit of heat-labile enterotoxin from e. coli carrying a peptide with anti-hsv activity
Class: toxin
Keywords: b subunit, heat-labile enterotoxin anti-hsv
Deposited on 1999-01-04, released 1999-01-13
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 3.3 Å
R-factor: 0.212
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'D':
    Compound: protein (b-pol subunit of heat-labile enterotoxin)
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P13811 (0-102)
      • conflict (102)
    Domains in SCOPe 2.07: d1b44d_
  • Chain 'E':
    Compound: protein (b-pol subunit of heat-labile enterotoxin)
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P13811 (0-102)
      • conflict (102)
    Domains in SCOPe 2.07: d1b44e_
  • Chain 'F':
    Compound: protein (b-pol subunit of heat-labile enterotoxin)
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P13811 (0-102)
      • conflict (102)
    Domains in SCOPe 2.07: d1b44f_
  • Chain 'G':
    Compound: protein (b-pol subunit of heat-labile enterotoxin)
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P13811 (0-102)
      • conflict (102)
    Domains in SCOPe 2.07: d1b44g_
  • Chain 'H':
    Compound: protein (b-pol subunit of heat-labile enterotoxin)
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P13811 (0-102)
      • conflict (102)
    Domains in SCOPe 2.07: d1b44h_

PDB Chain Sequences:

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1b44D (D:)
    apqsitelcseyhntqiytindkilsytesmagkremviitfksgatfqvevpgsqhids
    qkkaiermkdtlrityltetkidklcvwnnktpnsiaaismeklagfgavgagataeetr
    mlhafdtla
    

    Sequence, based on observed residues (ATOM records): (download)
    >1b44D (D:)
    apqsitelcseyhntqiytindkilsytesmagkremviitfksgatfqvevpgsqhids
    qkkaiermkdtlrityltetkidklcvwnnktpnsiaaismeklag
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1b44E (E:)
    apqsitelcseyhntqiytindkilsytesmagkremviitfksgatfqvevpgsqhids
    qkkaiermkdtlrityltetkidklcvwnnktpnsiaaismeklagfgavgagataeetr
    mlhafdtla
    

    Sequence, based on observed residues (ATOM records): (download)
    >1b44E (E:)
    apqsitelcseyhntqiytindkilsytesmagkremviitfksgatfqvevpgsqhids
    qkkaiermkdtlrityltetkidklcvwnnktpnsiaaismeklagf
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1b44F (F:)
    apqsitelcseyhntqiytindkilsytesmagkremviitfksgatfqvevpgsqhids
    qkkaiermkdtlrityltetkidklcvwnnktpnsiaaismeklagfgavgagataeetr
    mlhafdtla
    

    Sequence, based on observed residues (ATOM records): (download)
    >1b44F (F:)
    apqsitelcseyhntqiytindkilsytesmagkremviitfksgatfqvevpgsqhids
    qkkaiermkdtlrityltetkidklcvwnnktpnsiaaismeklag
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >1b44G (G:)
    apqsitelcseyhntqiytindkilsytesmagkremviitfksgatfqvevpgsqhids
    qkkaiermkdtlrityltetkidklcvwnnktpnsiaaismeklagfgavgagataeetr
    mlhafdtla
    

    Sequence, based on observed residues (ATOM records): (download)
    >1b44G (G:)
    apqsitelcseyhntqiytindkilsytesmagkremviitfksgatfqvevpgsqhids
    qkkaiermkdtlrityltetkidklcvwnnktpnsiaaismeklag
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >1b44H (H:)
    apqsitelcseyhntqiytindkilsytesmagkremviitfksgatfqvevpgsqhids
    qkkaiermkdtlrityltetkidklcvwnnktpnsiaaismeklagfgavgagataeetr
    mlhafdtla
    

    Sequence, based on observed residues (ATOM records): (download)
    >1b44H (H:)
    apqsitelcseyhntqiytindkilsytesmagkremviitfksgatfqvevpgsqhids
    qkkaiermkdtlrityltetkidklcvwnnktpnsiaaismeklag