PDB entry 1b43

View 1b43 on RCSB PDB site
Description: fen-1 from p. furiosus
Deposited on 1999-01-05, released 2000-01-12
The last revision prior to the SCOP 1.55 freeze date was dated 2000-01-12, with a file datestamp of 2000-01-11.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.231
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1b43A (A:)
    gvpigeiiprkeielenlygkkiaidalnaiyqflstirqkdgtplmdskgritshlsgl
    fyrtinlmeagikpvyvfdgeppefkkkelekrreareeaeekwrealekgeieearkya
    qratrvnemliedakkllelmgipivqapsegeaqaaymaakgsvyasasqdydsllfga
    prlvrnltitgkrklpgknvyveikpeliileevlkelkltreklielailvgtdynpgg
    ikgiglkkaleivrhskdplakfqkqsdvdlyaikefflnppvtdnynlvwrdpdeegil
    kflcdehdfseervknglerlkkaiksgkqstleswfkr
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1b43B (B:)
    gvpigeiiprkeielenlygkkiaidalnaiyqflstirqkdgtplmdskgritshlsgl
    fyrtinlmeagikpvyvfdgeppefkkkelekrreareeaeekwrealekgeieearkya
    qratrvnemliedakkllelmgipivqapsegeaqaaymaakgsvyasasqdydsllfga
    prlvrnltitgkrklpgknvyveikpeliileevlkelkltreklielailvgtdynpgg
    ikgiglkkaleivrhskdplakfqkqsdvdlyaikefflnppvtdnynlvwrdpdeegil
    kflcdehdfseervknglerlkkaiksgkqstleswfkr