PDB entry 1b43

View 1b43 on RCSB PDB site
Description: fen-1 from p. furiosus
Class: transferase
Keywords: nuclease, DNA repair, DNA replication, transferase
Deposited on 1999-01-05, released 2000-01-12
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.231
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (fen-1)
    Species: Pyrococcus furiosus [TaxId:2261]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1b43a1, d1b43a2
  • Chain 'B':
    Compound: protein (fen-1)
    Species: Pyrococcus furiosus [TaxId:2261]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1b43b1, d1b43b2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1b43A (A:)
    mgvpigeiiprkeielenlygkkiaidalnaiyqflstirqkdgtplmdskgritshlsg
    lfyrtinlmeagikpvyvfdgeppefkkkelekrreareeaeekwrealekgeieearky
    aqratrvnemliedakkllelmgipivqapsegeaqaaymaakgsvyasasqdydsllfg
    aprlvrnltitgkrklpgknvyveikpeliileevlkelkltreklielailvgtdynpg
    gikgiglkkaleivrhskdplakfqkqsdvdlyaikefflnppvtdnynlvwrdpdeegi
    lkflcdehdfseervknglerlkkaiksgkqstleswfkr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1b43A (A:)
    gvpigeiiprkeielenlygkkiaidalnaiyqflstirqkdgtplmdskgritshlsgl
    fyrtinlmeagikpvyvfdgeppefkkkelekrreareeaeekwrealekgeieearkya
    qratrvnemliedakkllelmgipivqapsegeaqaaymaakgsvyasasqdydsllfga
    prlvrnltitgkrklpgknvyveikpeliileevlkelkltreklielailvgtdynpgg
    ikgiglkkaleivrhskdplakfqkqsdvdlyaikefflnppvtdnynlvwrdpdeegil
    kflcdehdfseervknglerlkkaiksgkqstleswfkr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1b43B (B:)
    mgvpigeiiprkeielenlygkkiaidalnaiyqflstirqkdgtplmdskgritshlsg
    lfyrtinlmeagikpvyvfdgeppefkkkelekrreareeaeekwrealekgeieearky
    aqratrvnemliedakkllelmgipivqapsegeaqaaymaakgsvyasasqdydsllfg
    aprlvrnltitgkrklpgknvyveikpeliileevlkelkltreklielailvgtdynpg
    gikgiglkkaleivrhskdplakfqkqsdvdlyaikefflnppvtdnynlvwrdpdeegi
    lkflcdehdfseervknglerlkkaiksgkqstleswfkr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1b43B (B:)
    gvpigeiiprkeielenlygkkiaidalnaiyqflstirqkdgtplmdskgritshlsgl
    fyrtinlmeagikpvyvfdgeppefkkkelekrreareeaeekwrealekgeieearkya
    qratrvnemliedakkllelmgipivqapsegeaqaaymaakgsvyasasqdydsllfga
    prlvrnltitgkrklpgknvyveikpeliileevlkelkltreklielailvgtdynpgg
    ikgiglkkaleivrhskdplakfqkqsdvdlyaikefflnppvtdnynlvwrdpdeegil
    kflcdehdfseervknglerlkkaiksgkqstleswfkr