PDB entry 1b3y

View 1b3y on RCSB PDB site
Description: xylanase from penicillium simplicissimum, complex with xylotetraose
Class: family 10 xylanase
Keywords: family 10 xylanase, penicillium simplicissimum, glycosyl hydrolase, substrate binding
Deposited on 1998-12-15, released 1999-04-06
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.45 Å
R-factor: 0.191
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (xylanase)
    Species: Penicillium simplicissimum [TaxId:69488]
    Database cross-references and differences (RAF-indexed):
    • GB AF070417 (0-301)
      • modified residue (0)
    Domains in SCOPe 2.07: d1b3ya_
  • Heterogens: XYS, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1b3yA (A:)
    easvsidakfkahgkkylgtigdqytltkntknpaiikadfgqltpensmkwdatepnrg
    qftfsgsdylvnfaqsngklirghtlvwhsqlpgwvssitdkntlisvlknhittvmtry
    kgkiyawdvlneifnedgslrnsvfynvigedyvriafetarsvdpnaklyindynldsa
    gyskvngmvshvkkwlaagipidgigsqthlgagagsavagalnalasagtkeiaiteld
    iagasstdyvnvvnaclnqakcvgitvwgvadpdswrsssspllfdgnynpkaaynaian
    al