PDB entry 1b3x

View 1b3x on RCSB PDB site
Description: xylanase from penicillium simplicissimum, complex with xylotriose
Class: family 10 xylanase
Keywords: family 10 xylanase, penicillium simplicissimum, glycosyl hydrolase, substrate binding
Deposited on 1998-12-15, released 1999-04-07
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.188
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (xylanase)
    Species: Penicillium simplicissimum [TaxId:69488]
    Database cross-references and differences (RAF-indexed):
    • GB AF070417 (0-301)
      • modified residue (0)
    Domains in SCOPe 2.07: d1b3xa_
  • Heterogens: XYP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1b3xA (A:)
    easvsidakfkahgkkylgtigdqytltkntknpaiikadfgqltpensmkwdatepnrg
    qftfsgsdylvnfaqsngklirghtlvwhsqlpgwvssitdkntlisvlknhittvmtry
    kgkiyawdvlneifnedgslrnsvfynvigedyvriafetarsvdpnaklyindynldsa
    gyskvngmvshvkkwlaagipidgigsqthlgagagsavagalnalasagtkeiaiteld
    iagasstdyvnvvnaclnqakcvgitvwgvadpdswrsssspllfdgnynpkaaynaian
    al