PDB entry 1b3u

View 1b3u on RCSB PDB site
Description: crystal structure of constant regulatory domain of human pp2a, pr65alpha
Deposited on 1998-12-14, released 1999-02-09
The last revision prior to the SCOP 1.71 freeze date was dated 1999-04-12, with a file datestamp of 1999-04-11.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.209
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.71: d1b3ua_
  • Chain 'B':
    Domains in SCOP 1.71: d1b3ub_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1b3uA (A:)
    aaadgddslypiavlidelrnedvqlrlnsikklstialalgvertrsellpfltdtiyd
    edevllalaeqlgtfttlvggpeyvhcllppleslatveetvvrdkaveslraishehsp
    sdleahfvplvkrlaggdwftsrtsacglfsvcyprvssavkaelrqyfrnlcsddtpmv
    rraaasklgefakvleldnvkseiipmfsnlasdeqdsvrllaveacvniaqllpqedle
    alvmptlrqaaedkswrvrymvadkftelqkavgpeitktdlvpafqnlmkdceaevraa
    ashkvkefcenlsadcrenvimsqilpcikelvsdanqhvksalasvimglspilgkdnt
    iehllplflaqlkdecpevrlniisnldcvnevigirqlsqsllpaivelaedakwrvrl
    aiieympllagqlgveffdeklnslcmawlvdhvyaireaatsnlkklvekfgkewahat
    iipkvlamsgdpnylhrmttlfcinvlsevcgqdittkhmlptvlrmagdpvanvrfnva
    kslqkigpildnstlqsevkpilekltqdqdvdvkyfaqealtvlsla
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1b3uB (B:)
    aaadgddslypiavlidelrnedvqlrlnsikklstialalgvertrsellpfltdtiyd
    edevllalaeqlgtfttlvggpeyvhcllppleslatveetvvrdkaveslraishehsp
    sdleahfvplvkrlaggdwftsrtsacglfsvcyprvssavkaelrqyfrnlcsddtpmv
    rraaasklgefakvleldnvkseiipmfsnlasdeqdsvrllaveacvniaqllpqedle
    alvmptlrqaaedkswrvrymvadkftelqkavgpeitktdlvpafqnlmkdceaevraa
    ashkvkefcenlsadcrenvimsqilpcikelvsdanqhvksalasvimglspilgkdnt
    iehllplflaqlkdecpevrlniisnldcvnevigirqlsqsllpaivelaedakwrvrl
    aiieympllagqlgveffdeklnslcmawlvdhvyaireaatsnlkklvekfgkewahat
    iipkvlamsgdpnylhrmttlfcinvlsevcgqdittkhmlptvlrmagdpvanvrfnva
    kslqkigpildnstlqsevkpilekltqdqdvdvkyfaqealtvlsla