PDB entry 1b3t

View 1b3t on RCSB PDB site
Description: ebna-1 nuclear protein/DNA complex
Class: protein/DNA
Keywords: nuclear protein, protein-DNA complex, DNA-binding, activator, origin-binding protein, protein/DNA complex
Deposited on 1998-12-14, released 1998-12-15
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.208
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (nuclear protein ebna1)
    Species: Human herpesvirus 4 [TaxId:10376]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1b3ta_
  • Chain 'B':
    Compound: protein (nuclear protein ebna1)
    Species: Human herpesvirus 4 [TaxId:10376]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1b3tb_
  • Chain 'C':
    Compound: DNA (5'-d(*gp*gp*gp*ap*ap*gp*cp*ap*tp*ap*tp*gp*cp*tp*tp*cp*cp*c)-3')
  • Chain 'D':
    Compound: DNA (5'-d(*gp*gp*gp*ap*ap*gp*cp*ap*tp*ap*tp*gp*cp*tp*tp*cp*cp*c)-3')
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1b3tA (A:)
    kggwfgkhrgqggsnpkfeniaeglrallarshverttdegtwvagvfvyggsktslynl
    rrgtalaipqcrltplsrlpfgmapgpgpqpgplresivcyfmvflqthifaevlkdaik
    dlvmtkpaptcnirvtvcsfddgvdlp
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1b3tB (B:)
    kggwfgkhrgqggsnpkfeniaeglrallarshverttdegtwvagvfvyggsktslynl
    rrgtalaipqcrltplsrlpfgmapgpgpqpgplresivcyfmvflqthifaevlkdaik
    dlvmtkpaptcnirvtvcsfddgvdlp
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.