PDB entry 1b3t

View 1b3t on RCSB PDB site
Description: ebna-1 nuclear protein/dna complex
Deposited on 1998-12-14, released 1998-12-15
The last revision prior to the SCOP 1.55 freeze date was dated 1999-12-29, with a file datestamp of 1999-12-28.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.208
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.55: d1b3ta_
  • Chain 'B':
    Domains in SCOP 1.55: d1b3tb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1b3tA (A:)
    kggwfgkhrgqggsnpkfeniaeglrallarshverttdegtwvagvfvyggsktslynl
    rrgtalaipqcrltplsrlpfgmapgpgpqpgplresivcyfmvflqthifaevlkdaik
    dlvmtkpaptcnirvtvcsfddgvdlp
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1b3tB (B:)
    kggwfgkhrgqggsnpkfeniaeglrallarshverttdegtwvagvfvyggsktslynl
    rrgtalaipqcrltplsrlpfgmapgpgpqpgplresivcyfmvflqthifaevlkdaik
    dlvmtkpaptcnirvtvcsfddgvdlp