PDB entry 1b3s

View 1b3s on RCSB PDB site
Description: structural response to mutation at a protein-protein interface
Deposited on 1998-12-01, released 1998-12-09
The last revision prior to the SCOP 1.55 freeze date was dated 2000-05-23, with a file datestamp of 2000-05-23.
Experiment type: XRAY
Resolution: 2.39 Å
R-factor: 0.247
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.55: d1b3sa_
  • Chain 'B':
    Domains in SCOP 1.55: d1b3sb_
  • Chain 'C':
    Domains in SCOP 1.55: d1b3sc_
  • Chain 'D':
    Domains in SCOP 1.55: d1b3sd_
  • Chain 'E':
    Domains in SCOP 1.55: d1b3se_
  • Chain 'F':
    Domains in SCOP 1.55: d1b3sf_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1b3sA (A:)
    aqvintfdgvadylqtyhklpdnyitkseaqalgwvaskgnladvapgksiggdifsnre
    gklpgksgrtwreadinytsgfrnsdrilyssdwliykttdayqtftkir
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1b3sB (B:)
    aqvintfdgvadylqtyhklpdnyitkseaqalgwvaskgnladvapgksiggdifsnre
    gklpgksgrtwreadinytsgfrnsdrilyssdwliykttdayqtftkir
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1b3sC (C:)
    vintfdgvadylqtyhklpdnyitkseaqalgwvaskgnladvapgksiggdifsnregk
    lpgksgrtwreadinytsgfrnsdrilyssdwliykttdayqtftkir
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1b3sD (D:)
    mkkavingeqirsisdlhqtlkkelalpefygenldalwdcltgwveyplvlewrqfeqs
    kqltengaesvlqvfreakaegcditiils
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1b3sE (E:)
    kkavingeqirsisdlhqtlkkelalpefygenldalwdcltgwveyplvlewrqfeqsk
    qltengaesvlqvfreakaegcditiils
    

    Sequence, based on observed residues (ATOM records): (download)
    >1b3sE (E:)
    kkavingeqirsisdlhqtlkkelalpefygenldalwdcltgwveyplvlewrqfgaes
    vlqvfreakaegcditiils
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1b3sF (F:)
    kkavingeqirsisdlhqtlkkelalpefygenldalwdcltgwveyplvlewrqfeqsk
    qltengaesvlqvfreakaegcditiils