PDB entry 1b3r

View 1b3r on RCSB PDB site
Description: rat liver s-adenosylhomocystein hydrolase
Class: hydrolase
Keywords: adeonsylhomocysteine, hydrolase, adohcy, adohcyase
Deposited on 1998-12-14, released 1998-12-23
The last revision prior to the SCOPe 2.05 freeze date was dated 2010-03-02, with a file datestamp of 2010-02-26.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.199
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (s-adenosylhomocysteine hydrolase)
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1b3ra1, d1b3ra2
  • Chain 'B':
    Compound: protein (s-adenosylhomocysteine hydrolase)
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1b3rb1, d1b3rb2
  • Chain 'C':
    Compound: protein (s-adenosylhomocysteine hydrolase)
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1b3rc1, d1b3rc2
  • Chain 'D':
    Compound: protein (s-adenosylhomocysteine hydrolase)
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1b3rd1, d1b3rd2
  • Heterogens: NAD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1b3rA (A:)
    adklpykvadiglaawgrkaldiaenempglmrmremysaskplkgariagclhmtveta
    vlietlvalgaevrwsscnifstqdhaaaaiakagipvfawkgetdeeylwcieqtlhfk
    dgplnmilddggdltnlihtkhpqllsgirgiseetttgvhnlykmmangilkvpainvn
    dsvtkskfdnlygcreslidgikratdvmiagkvavvagygdvgkgcaqalrgfgarvii
    teidpinalqaamegyevttmdeackegnifvtttgcvdiilgrhfeqmkddaivcnigh
    fdveidvkwlnenavekvnikpqvdryllknghriillaegrlvnlgcamghpsfvmsns
    ftnqvmaqielwthpdkypvgvhflpkkldeavaeahlgklnvkltkltekqaqylgmpi
    ngpfkpdhyry
    

    Sequence, based on observed residues (ATOM records): (download)
    >1b3rA (A:)
    lpykvadiglaawgrkaldiaenempglmrmremysaskplkgariagclhmtvetavli
    etlvalgaevrwsscnifstqdhaaaaiakagipvfawkgetdeeylwcieqtlhfkdgp
    lnmilddggdltnlihtkhpqllsgirgiseetttgvhnlykmmangilkvpainvndsv
    tkskfdnlygcreslidgikratdvmiagkvavvagygdvgkgcaqalrgfgarviitei
    dpinalqaamegyevttmdeackegnifvtttgcvdiilgrhfeqmkddaivcnighfdv
    eidvkwlnenavekvnikpqvdryllknghriillaegrlvnlgcamghpsfvmsnsftn
    qvmaqielwthpdkypvgvhflpkkldeavaeahlgklnvkltkltekqaqylgmpingp
    fkpdhyry
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1b3rB (B:)
    adklpykvadiglaawgrkaldiaenempglmrmremysaskplkgariagclhmtveta
    vlietlvalgaevrwsscnifstqdhaaaaiakagipvfawkgetdeeylwcieqtlhfk
    dgplnmilddggdltnlihtkhpqllsgirgiseetttgvhnlykmmangilkvpainvn
    dsvtkskfdnlygcreslidgikratdvmiagkvavvagygdvgkgcaqalrgfgarvii
    teidpinalqaamegyevttmdeackegnifvtttgcvdiilgrhfeqmkddaivcnigh
    fdveidvkwlnenavekvnikpqvdryllknghriillaegrlvnlgcamghpsfvmsns
    ftnqvmaqielwthpdkypvgvhflpkkldeavaeahlgklnvkltkltekqaqylgmpi
    ngpfkpdhyry
    

    Sequence, based on observed residues (ATOM records): (download)
    >1b3rB (B:)
    lpykvadiglaawgrkaldiaenempglmrmremysaskplkgariagclhmtvetavli
    etlvalgaevrwsscnifstqdhaaaaiakagipvfawkgetdeeylwcieqtlhfkdgp
    lnmilddggdltnlihtkhpqllsgirgiseetttgvhnlykmmangilkvpainvndsv
    tkskfdnlygcreslidgikratdvmiagkvavvagygdvgkgcaqalrgfgarviitei
    dpinalqaamegyevttmdeackegnifvtttgcvdiilgrhfeqmkddaivcnighfdv
    eidvkwlnenavekvnikpqvdryllknghriillaegrlvnlgcamghpsfvmsnsftn
    qvmaqielwthpdkypvgvhflpkkldeavaeahlgklnvkltkltekqaqylgmpingp
    fkpdhyry
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1b3rC (C:)
    adklpykvadiglaawgrkaldiaenempglmrmremysaskplkgariagclhmtveta
    vlietlvalgaevrwsscnifstqdhaaaaiakagipvfawkgetdeeylwcieqtlhfk
    dgplnmilddggdltnlihtkhpqllsgirgiseetttgvhnlykmmangilkvpainvn
    dsvtkskfdnlygcreslidgikratdvmiagkvavvagygdvgkgcaqalrgfgarvii
    teidpinalqaamegyevttmdeackegnifvtttgcvdiilgrhfeqmkddaivcnigh
    fdveidvkwlnenavekvnikpqvdryllknghriillaegrlvnlgcamghpsfvmsns
    ftnqvmaqielwthpdkypvgvhflpkkldeavaeahlgklnvkltkltekqaqylgmpi
    ngpfkpdhyry
    

    Sequence, based on observed residues (ATOM records): (download)
    >1b3rC (C:)
    lpykvadiglaawgrkaldiaenempglmrmremysaskplkgariagclhmtvetavli
    etlvalgaevrwsscnifstqdhaaaaiakagipvfawkgetdeeylwcieqtlhfkdgp
    lnmilddggdltnlihtkhpqllsgirgiseetttgvhnlykmmangilkvpainvndsv
    tkskfdnlygcreslidgikratdvmiagkvavvagygdvgkgcaqalrgfgarviitei
    dpinalqaamegyevttmdeackegnifvtttgcvdiilgrhfeqmkddaivcnighfdv
    eidvkwlnenavekvnikpqvdryllknghriillaegrlvnlgcamghpsfvmsnsftn
    qvmaqielwthpdkypvgvhflpkkldeavaeahlgklnvkltkltekqaqylgmpingp
    fkpdhyry
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1b3rD (D:)
    adklpykvadiglaawgrkaldiaenempglmrmremysaskplkgariagclhmtveta
    vlietlvalgaevrwsscnifstqdhaaaaiakagipvfawkgetdeeylwcieqtlhfk
    dgplnmilddggdltnlihtkhpqllsgirgiseetttgvhnlykmmangilkvpainvn
    dsvtkskfdnlygcreslidgikratdvmiagkvavvagygdvgkgcaqalrgfgarvii
    teidpinalqaamegyevttmdeackegnifvtttgcvdiilgrhfeqmkddaivcnigh
    fdveidvkwlnenavekvnikpqvdryllknghriillaegrlvnlgcamghpsfvmsns
    ftnqvmaqielwthpdkypvgvhflpkkldeavaeahlgklnvkltkltekqaqylgmpi
    ngpfkpdhyry
    

    Sequence, based on observed residues (ATOM records): (download)
    >1b3rD (D:)
    lpykvadiglaawgrkaldiaenempglmrmremysaskplkgariagclhmtvetavli
    etlvalgaevrwsscnifstqdhaaaaiakagipvfawkgetdeeylwcieqtlhfkdgp
    lnmilddggdltnlihtkhpqllsgirgiseetttgvhnlykmmangilkvpainvndsv
    tkskfdnlygcreslidgikratdvmiagkvavvagygdvgkgcaqalrgfgarviitei
    dpinalqaamegyevttmdeackegnifvtttgcvdiilgrhfeqmkddaivcnighfdv
    eidvkwlnenavekvnikpqvdryllknghriillaegrlvnlgcamghpsfvmsnsftn
    qvmaqielwthpdkypvgvhflpkkldeavaeahlgklnvkltkltekqaqylgmpingp
    fkpdhyry