PDB entry 1b3o

View 1b3o on RCSB PDB site
Description: ternary complex of human type-ii inosine monophosphate dehydrogenase with 6-cl-imp and selenazole adenine dinucleotide
Deposited on 1998-12-14, released 1999-04-12
The last revision prior to the SCOP 1.71 freeze date was dated 1999-04-22, with a file datestamp of 1999-04-21.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: 0.244
AEROSPACI score: 0.1 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1b3oA (A:)
    madylisggtsyvpddgltaqqlfncgdgltyndflilpgyidftadqvdltsaltkkit
    lktplvsspmdtvteagmaiamaltggigfihhnctpefqanevrkvkkyeqgfitdpvv
    lspkdrvrdvfeakarhgfcgipitdtgrmgsrlvgiissrdidflkeeehdcfleeimt
    kredlvvapagitlkeaneilqrskkgklpivneddelvaiiartdlkknrdyplaskda
    kkqllcgaaigtheddkyrldllaqagvdvvvldssqgnsifqinmikyikdkypnlqvi
    ggnvvtaaqaknlidagvdalrvgmgsgsicitqevlacgrpqatavykvseyarrfgvp
    viadggiqnvghiakalalgastvmmgsllaatteapgeyffsdgirlkkyrgmgsldam
    dkhlssqnryfseadkikvaqgvsgavqdkgsihkfvpyliagiqhscqdigaksltqvr
    ammysgelkfekrtssaqveggvhslhsyekrlf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1b3oA (A:)
    tsyvpddgltaqqlfncgdgltyndflilpgyidftadqvdltsaltkkitlktplvssp
    mdtvteagmaiamaltggigfihhnctpefqanevrkvkkdyplaskdakkqllcgaaig
    theddkyrldllaqagvdvvvldssqgnsifqinmikyikdkypnlqviggnvvtaaqak
    nlidagvdalrvgmgsrpqatavykvseyarrfgvpviadggiqnvghiakalalgastv
    mmgsllaatteapgeydkgsihkfvpyliagiqhscqdigaksltqvrammysgelkfek
    rtssaqv
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1b3oB (B:)
    madylisggtsyvpddgltaqqlfncgdgltyndflilpgyidftadqvdltsaltkkit
    lktplvsspmdtvteagmaiamaltggigfihhnctpefqanevrkvkkyeqgfitdpvv
    lspkdrvrdvfeakarhgfcgipitdtgrmgsrlvgiissrdidflkeeehdcfleeimt
    kredlvvapagitlkeaneilqrskkgklpivneddelvaiiartdlkknrdyplaskda
    kkqllcgaaigtheddkyrldllaqagvdvvvldssqgnsifqinmikyikdkypnlqvi
    ggnvvtaaqaknlidagvdalrvgmgsgsicitqevlacgrpqatavykvseyarrfgvp
    viadggiqnvghiakalalgastvmmgsllaatteapgeyffsdgirlkkyrgmgsldam
    dkhlssqnryfseadkikvaqgvsgavqdkgsihkfvpyliagiqhscqdigaksltqvr
    ammysgelkfekrtssaqveggvhslhsyekrlf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1b3oB (B:)
    tsyvpddgltaqqlfncgdgltyndflilpgyidftadqvdltsaltkkitlktplvssp
    mdtvteagmaiamaltggigfihhnctpefqanevrkvkkyeqgfitdpvvlspkdrvrd
    cgipitdtgrmgsrlvgiisimtkredlvvapagitlkeaneilqrskkgklpivnedde
    lvaiiartdlkknrdyplaskdakkqllcgaaigtheddkyrldllaqagvdvvvldssq
    gnsifqinmikyikdkypnlqviggnvvtaaqaknlidagvdalrvgmgsgsicitqevl
    acgrpqatavykvseyarrfgvpviadggiqnvghiakalalgastvmmgsllaatteap
    geydkgsihkfvpyliagiqhscqdigaksltqvrammysgelkfekrtssaqv