PDB entry 1b3n

View 1b3n on RCSB PDB site
Description: beta-ketoacyl carrier protein synthase as a drug target, implications from the crystal structure of a complex with the inhibitor cerulenin.
Class: condensing enzymes
Keywords: condensing enzymes, fatty acid elongation, cerulenin inhibition, lipid metabolism, drug design, drug target
Deposited on 1998-12-14, released 1999-04-06
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.65 Å
R-factor: 0.213
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (ketoacyl acyl carrier protein synthase 2)
    Species: Escherichia coli [TaxId:83333]
    Gene: fabF
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1b3na1, d1b3na2
  • Heterogens: CER, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1b3nA (A:)
    skrrvvvtglgmlspvgntvestwkallagqsgislidhfdtsayatkfaglvkdfnced
    iisrkeqrkmdafiqygivagvqamqdsgleiteenatrigaaigsgigglglieenhts
    lmnggprkispffvpstivnmvaghltimyglrgpsisiatactsgvhnighaariiayg
    dadvmvaggaekastplgvggfgaaralstrndnpqaasrpwdkerdgfvlgdgagmlvl
    eeyehakkrgakiyaelvgfgmssdayhmtsppengagaalamanalrdagieasqigyv
    nahgtstpagdkaeaqavktifgeaasrvlvsstksmtghllgaagavesiysilalrdq
    avpptinldnpdegcdldfvphearqvsgmeytlcnsfgfggtngslifkki
    

    Sequence, based on observed residues (ATOM records): (download)
    >1b3nA (A:)
    krrvvvtglgmlspvgntvestwkallagqsgislidhfdtsayatkfaglvkdfncedi
    isrkeqrkmdafiqygivagvqamqdsgleiteenatrigaaigsgigglglieenhtsl
    mnggprkispffvpstivnmvaghltimyglrgpsisiatactsgvhnighaariiaygd
    advmvaggaekastplgvggfgaaralstrndnpqaasrpwdkerdgfvlgdgagmlvle
    eyehakkrgakiyaelvgfgmssdayhmtsppengagaalamanalrdagieasqigyvn
    ahgtstpagdkaeaqavktifgeaasrvlvsstksmtghllgaagavesiysilalrdqa
    vpptinldnpdegcdldfvphearqvsgmeytlcnsfgfggtngslifkki