PDB entry 1b3l

View 1b3l on RCSB PDB site
Description: oligo-peptide binding protein (oppa) complexed with kgk
Class: peptide binding protein
Keywords: complex (peptide transport/peptide), peptide transport, peptide binding protein
Deposited on 1998-12-11, released 1998-12-16
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.178
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (oligo-peptide binding protein)
    Species: Salmonella typhimurium [TaxId:602]
    Gene: OPPA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1b3la_
  • Chain 'B':
    Compound: protein (lys-gly-lys)
    Database cross-references and differences (RAF-indexed):
    • PDB 1B3L (0-2)
  • Chain 'C':
    Compound: protein (oligo-peptide binding protein)
    Species: Salmonella typhimurium [TaxId:602]
    Gene: OPPA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1b3lc_
  • Chain 'D':
    Compound: protein (lys-gly-lys)
    Database cross-references and differences (RAF-indexed):
    • PDB 1B3L (0-2)
  • Heterogens: IUM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1b3lA (A:)
    advpagvqladkqtlvrnngsevqsldphkiegvpesnvsrdlfegllisdveghpspgv
    aekwenkdfkvwtfhlrenakwsdgtpvtahdfvyswqrladpntaspyasylqyghian
    iddiiagkkpatdlgvkalddhtfevtlsepvpyfykllvhpsvspvpksavekfgdkwt
    qpanivtngayklknwvvnerivlernpqywdnaktvinqvtylpissevtdvnryrsge
    idmtynnmpielfqklkkeipnevrvdpylctyyyeinnqkapfndvrvrtalklaldrd
    iivnkvknqgdlpaysytppytdgaklvepewfkwsqqkrneeakkllaeagftadkplt
    fdllyntsdlhkklaiavasiwkknlgvnvnlenqewktfldtrhqgtfdvaragwcady
    neptsflntmlsdssnntahykspafdkliadtlkvaddtqrselyakaeqqldkdsaiv
    pvyyyvnarlvkpwvggytgkdpldniyvknlyiikh
    

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1b3lC (C:)
    advpagvqladkqtlvrnngsevqsldphkiegvpesnvsrdlfegllisdveghpspgv
    aekwenkdfkvwtfhlrenakwsdgtpvtahdfvyswqrladpntaspyasylqyghian
    iddiiagkkpatdlgvkalddhtfevtlsepvpyfykllvhpsvspvpksavekfgdkwt
    qpanivtngayklknwvvnerivlernpqywdnaktvinqvtylpissevtdvnryrsge
    idmtynnmpielfqklkkeipnevrvdpylctyyyeinnqkapfndvrvrtalklaldrd
    iivnkvknqgdlpaysytppytdgaklvepewfkwsqqkrneeakkllaeagftadkplt
    fdllyntsdlhkklaiavasiwkknlgvnvnlenqewktfldtrhqgtfdvaragwcady
    neptsflntmlsdssnntahykspafdkliadtlkvaddtqrselyakaeqqldkdsaiv
    pvyyyvnarlvkpwvggytgkdpldniyvknlyiikh
    

  • Chain 'D':
    No sequence available.