PDB entry 1b3k

View 1b3k on RCSB PDB site
Description: plasminogen activator inhibitor-1
Deposited on 1998-12-11, released 1999-12-10
The last revision prior to the SCOP 1.55 freeze date was dated 2000-02-03, with a file datestamp of 2000-02-03.
Experiment type: XRAY
Resolution: 2.99 Å
R-factor: 0.247
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.55: d1b3ka_
  • Chain 'B':
    Domains in SCOP 1.55: d1b3kb_
  • Chain 'C':
    Domains in SCOP 1.55: d1b3kc_
  • Chain 'D':
    Domains in SCOP 1.55: d1b3kd_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1b3kA (A:)
    yvahlasdfgvrvfqqvaqaskdrnvvfspygvasvlamlqlttggetqqqiqaamgfki
    ddkgmapalrhlykelmgpwnkdeisttdaifvqrdlklvqgfmphffrlfrstvkqvdf
    severarfiindwvkthtkgmishllgtgavdqltrlvlvnalyfngqwktpfpdssthr
    rlfhksdgstvsvpmmaqtnkfnytefttpdghyydilelpyhgdtlsmfiaapyekevp
    lsaltnilsaqlishwkgnmtrlprllvlpkfsletevdlrkplenlgmtdmfrqfqadf
    tslsdqeplhvalalqkvkievnesgtvassstavivsarmapeeiiidrpflfvvrhnp
    tgtvlfmgqvmep
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1b3kB (B:)
    yvahlasdfgvrvfqqvaqaskdrnvvfspygvasvlamlqlttggetqqqiqaamgfki
    ddkgmapalrhlykelmgpwnkdeisttdaifvqrdlklvqgfmphffrlfrstvkqvdf
    severarfiindwvkthtkgmishllgtgavdqltrlvlvnalyfngqwktpfpdssthr
    rlfhksdgstvsvpmmaqtnkfnytefttpdghyydilelpyhgdtlsmfiaapyekevp
    lsaltnilsaqlishwkgnmtrlprllvlpkfsletevdlrkplenlgmtdmfrqfqadf
    tslsdqeplhvalalqkvkievnesgtvassstavivsarmapeeiiidrpflfvvrhnp
    tgtvlfmgqvmep
    

    Sequence, based on observed residues (ATOM records): (download)
    >1b3kB (B:)
    yvahlasdfgvrvfqqvaqaskdrnvvfspygvasvlamlqlttggetqqqiqaamgfki
    ddkgmapalrhlykelmgpwnkdeisttdaifvqrdlklvqgfmphffrlfrstvkqvdf
    severarfiindwvkthtkgmishllgtgavdqltrlvlvnalyfngqwktpfpdssthr
    rlfhksdgstvsvpmmaqtnkfnytefttpdghyydilelpyhgdtlsmfiaapyekevp
    lsaltnilsaqlishwkgnmtrlprllvlpkfsletevdlrkplenlgmtdmfrqfqadf
    tslsdqeplhvalalqkvkievnesgapeeiiidrpflfvvrhnptgtvlfmgqvmep
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1b3kC (C:)
    yvahlasdfgvrvfqqvaqaskdrnvvfspygvasvlamlqlttggetqqqiqaamgfki
    ddkgmapalrhlykelmgpwnkdeisttdaifvqrdlklvqgfmphffrlfrstvkqvdf
    severarfiindwvkthtkgmishllgtgavdqltrlvlvnalyfngqwktpfpdssthr
    rlfhksdgstvsvpmmaqtnkfnytefttpdghyydilelpyhgdtlsmfiaapyekevp
    lsaltnilsaqlishwkgnmtrlprllvlpkfsletevdlrkplenlgmtdmfrqfqadf
    tslsdqeplhvalalqkvkievnesgtvassstavivsarmapeeiiidrpflfvvrhnp
    tgtvlfmgqvmep
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1b3kD (D:)
    yvahlasdfgvrvfqqvaqaskdrnvvfspygvasvlamlqlttggetqqqiqaamgfki
    ddkgmapalrhlykelmgpwnkdeisttdaifvqrdlklvqgfmphffrlfrstvkqvdf
    severarfiindwvkthtkgmishllgtgavdqltrlvlvnalyfngqwktpfpdssthr
    rlfhksdgstvsvpmmaqtnkfnytefttpdghyydilelpyhgdtlsmfiaapyekevp
    lsaltnilsaqlishwkgnmtrlprllvlpkfsletevdlrkplenlgmtdmfrqfqadf
    tslsdqeplhvalalqkvkievnesgtvassstavivsarmapeeiiidrpflfvvrhnp
    tgtvlfmgqvmep
    

    Sequence, based on observed residues (ATOM records): (download)
    >1b3kD (D:)
    yvahlasdfgvrvfqqvaqaskdrnvvfspygvasvlamlqlttggetqqqiqaamgfki
    ddkgmapalrhlykelmgpwnkdeisttdaifvqrdlklvqgfmphffrlfrstvkqvdf
    severarfiindwvkthtkgmishllgtgavdqltrlvlvnalyfngqwktpfpdssthr
    rlfhksdgstvsvpmmaqtnkfnytefttpdghyydilelpyhgdtlsmfiaapyekevp
    lsaltnilsaqlishwkgnmtrlprllvlpkfsletevdlrkplenlgmtdmfrqfqadf
    tslsdqeplhvalalqkvkievnesgapeeiiidrpflfvvrhnptgtvlfmgqvmep