PDB entry 1b3k

View 1b3k on RCSB PDB site
Description: Plasminogen activator inhibitor-1
Class: blood clotting
Keywords: serpin, pai-1, inhibitor, blood clotting
Deposited on 1998-12-11, released 1999-12-10
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-04, with a file datestamp of 2017-09-29.
Experiment type: XRAY
Resolution: 2.99 Å
R-factor: N/A
AEROSPACI score: 0.13 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: plasminogen activator inhibitor-1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P05121 (Start-378)
      • engineered (149)
      • engineered (153)
      • engineered (318)
      • engineered (353)
    Domains in SCOPe 2.07: d1b3ka_
  • Chain 'B':
    Compound: plasminogen activator inhibitor-1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P05121 (Start-378)
      • engineered (149)
      • engineered (153)
      • engineered (318)
      • engineered (353)
    Domains in SCOPe 2.07: d1b3kb_
  • Chain 'C':
    Compound: plasminogen activator inhibitor-1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P05121 (Start-378)
      • engineered (149)
      • engineered (153)
      • engineered (318)
      • engineered (353)
    Domains in SCOPe 2.07: d1b3kc_
  • Chain 'D':
    Compound: plasminogen activator inhibitor-1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P05121 (Start-378)
      • engineered (149)
      • engineered (153)
      • engineered (318)
      • engineered (353)
    Domains in SCOPe 2.07: d1b3kd_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1b3kA (A:)
    vhhppsyvahlasdfgvrvfqqvaqaskdrnvvfspygvasvlamlqlttggetqqqiqa
    amgfkiddkgmapalrhlykelmgpwnkdeisttdaifvqrdlklvqgfmphffrlfrst
    vkqvdfseverarfiindwvkthtkgmishllgtgavdqltrlvlvnalyfngqwktpfp
    dssthrrlfhksdgstvsvpmmaqtnkfnytefttpdghyydilelpyhgdtlsmfiaap
    yekevplsaltnilsaqlishwkgnmtrlprllvlpkfsletevdlrkplenlgmtdmfr
    qfqadftslsdqeplhvalalqkvkievnesgtvassstavivsarmapeeiiidrpflf
    vvrhnptgtvlfmgqvmep
    

    Sequence, based on observed residues (ATOM records): (download)
    >1b3kA (A:)
    yvahlasdfgvrvfqqvaqaskdrnvvfspygvasvlamlqlttggetqqqiqaamgfki
    ddkgmapalrhlykelmgpwnkdeisttdaifvqrdlklvqgfmphffrlfrstvkqvdf
    severarfiindwvkthtkgmishllgtgavdqltrlvlvnalyfngqwktpfpdssthr
    rlfhksdgstvsvpmmaqtnkfnytefttpdghyydilelpyhgdtlsmfiaapyekevp
    lsaltnilsaqlishwkgnmtrlprllvlpkfsletevdlrkplenlgmtdmfrqfqadf
    tslsdqeplhvalalqkvkievnesgtvassstavivsarmapeeiiidrpflfvvrhnp
    tgtvlfmgqvmep
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1b3kB (B:)
    vhhppsyvahlasdfgvrvfqqvaqaskdrnvvfspygvasvlamlqlttggetqqqiqa
    amgfkiddkgmapalrhlykelmgpwnkdeisttdaifvqrdlklvqgfmphffrlfrst
    vkqvdfseverarfiindwvkthtkgmishllgtgavdqltrlvlvnalyfngqwktpfp
    dssthrrlfhksdgstvsvpmmaqtnkfnytefttpdghyydilelpyhgdtlsmfiaap
    yekevplsaltnilsaqlishwkgnmtrlprllvlpkfsletevdlrkplenlgmtdmfr
    qfqadftslsdqeplhvalalqkvkievnesgtvassstavivsarmapeeiiidrpflf
    vvrhnptgtvlfmgqvmep
    

    Sequence, based on observed residues (ATOM records): (download)
    >1b3kB (B:)
    yvahlasdfgvrvfqqvaqaskdrnvvfspygvasvlamlqlttggetqqqiqaamgfki
    ddkgmapalrhlykelmgpwnkdeisttdaifvqrdlklvqgfmphffrlfrstvkqvdf
    severarfiindwvkthtkgmishllgtgavdqltrlvlvnalyfngqwktpfpdssthr
    rlfhksdgstvsvpmmaqtnkfnytefttpdghyydilelpyhgdtlsmfiaapyekevp
    lsaltnilsaqlishwkgnmtrlprllvlpkfsletevdlrkplenlgmtdmfrqfqadf
    tslsdqeplhvalalqkvkievnesgapeeiiidrpflfvvrhnptgtvlfmgqvmep
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1b3kC (C:)
    vhhppsyvahlasdfgvrvfqqvaqaskdrnvvfspygvasvlamlqlttggetqqqiqa
    amgfkiddkgmapalrhlykelmgpwnkdeisttdaifvqrdlklvqgfmphffrlfrst
    vkqvdfseverarfiindwvkthtkgmishllgtgavdqltrlvlvnalyfngqwktpfp
    dssthrrlfhksdgstvsvpmmaqtnkfnytefttpdghyydilelpyhgdtlsmfiaap
    yekevplsaltnilsaqlishwkgnmtrlprllvlpkfsletevdlrkplenlgmtdmfr
    qfqadftslsdqeplhvalalqkvkievnesgtvassstavivsarmapeeiiidrpflf
    vvrhnptgtvlfmgqvmep
    

    Sequence, based on observed residues (ATOM records): (download)
    >1b3kC (C:)
    yvahlasdfgvrvfqqvaqaskdrnvvfspygvasvlamlqlttggetqqqiqaamgfki
    ddkgmapalrhlykelmgpwnkdeisttdaifvqrdlklvqgfmphffrlfrstvkqvdf
    severarfiindwvkthtkgmishllgtgavdqltrlvlvnalyfngqwktpfpdssthr
    rlfhksdgstvsvpmmaqtnkfnytefttpdghyydilelpyhgdtlsmfiaapyekevp
    lsaltnilsaqlishwkgnmtrlprllvlpkfsletevdlrkplenlgmtdmfrqfqadf
    tslsdqeplhvalalqkvkievnesgtvassstavivsarmapeeiiidrpflfvvrhnp
    tgtvlfmgqvmep
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1b3kD (D:)
    vhhppsyvahlasdfgvrvfqqvaqaskdrnvvfspygvasvlamlqlttggetqqqiqa
    amgfkiddkgmapalrhlykelmgpwnkdeisttdaifvqrdlklvqgfmphffrlfrst
    vkqvdfseverarfiindwvkthtkgmishllgtgavdqltrlvlvnalyfngqwktpfp
    dssthrrlfhksdgstvsvpmmaqtnkfnytefttpdghyydilelpyhgdtlsmfiaap
    yekevplsaltnilsaqlishwkgnmtrlprllvlpkfsletevdlrkplenlgmtdmfr
    qfqadftslsdqeplhvalalqkvkievnesgtvassstavivsarmapeeiiidrpflf
    vvrhnptgtvlfmgqvmep
    

    Sequence, based on observed residues (ATOM records): (download)
    >1b3kD (D:)
    yvahlasdfgvrvfqqvaqaskdrnvvfspygvasvlamlqlttggetqqqiqaamgfki
    ddkgmapalrhlykelmgpwnkdeisttdaifvqrdlklvqgfmphffrlfrstvkqvdf
    severarfiindwvkthtkgmishllgtgavdqltrlvlvnalyfngqwktpfpdssthr
    rlfhksdgstvsvpmmaqtnkfnytefttpdghyydilelpyhgdtlsmfiaapyekevp
    lsaltnilsaqlishwkgnmtrlprllvlpkfsletevdlrkplenlgmtdmfrqfqadf
    tslsdqeplhvalalqkvkievnesgapeeiiidrpflfvvrhnptgtvlfmgqvmep