PDB entry 1b3j

View 1b3j on RCSB PDB site
Description: structure of the mhc class i homolog mic-a, a gammadelta t cell ligand
Deposited on 1998-12-11, released 1999-07-09
The last revision prior to the SCOP 1.71 freeze date was dated 1999-07-09, with a file datestamp of 1999-07-08.
Experiment type: XRAY
Resolution: 3 Å
R-factor: 0.246
AEROSPACI score: 0.13 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1b3jA (A:)
    ephslrynltvlswdgsvqsgfltevhldgqpflrcdrqkcrakpqgqwaedvlgnktwd
    retrdltgngkdlrmtlahikdqkeglhslqeirvceihednstrssqhfyydgelflsq
    nletkewtmpqssraqtlamnvrnflkedamktkthyhamhadclqelrrylksgvvlrr
    tvppmvnvtrseasegnitvtcrasgfypwnitlswrqdgvslshdtqqwgdvlpdgngt
    yqtwvatricqgeeqrftcymehsgnhsthpvps
    

    Sequence, based on observed residues (ATOM records): (download)
    >1b3jA (A:)
    ephslrynltvlswdgsvqsgfltevhldgqpflrcdrqkcrakpqgqwaedvlgnktwd
    retrdltgngkdlrmtlahikdqkeglhslqeirvceihednstrssqhfyydgelflsq
    nletkewtmpqssraqtlamnvrnflkedamadclqelrrylksgvvlrrtvppmvnvtr
    seasegnitvtcrasgfypwnitlswrqdgvslshdtqqwgdvlpdgngtyqtwvatric
    qgeeqrftcymehsgnhsthpvps