PDB entry 1b3i

View 1b3i on RCSB PDB site
Description: nmr solution structure of plastocyanin from the photosynthetic prokaryote, prochlorothrix hollandica (minimized average structure)
Deposited on 1998-12-11, released 1999-04-27
The last revision prior to the SCOP 1.55 freeze date was dated 2000-05-18, with a file datestamp of 2000-05-18.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.55: d1b3ia_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1b3iA (A:)
    asvqikmgtdkyaplyepkalsisagdtvefvmnkvgphnvifdkvpagesapalsntkl
    aiapgsfysvtlgtpgtysfyctphrgagmvgtitve