PDB entry 1b3c

View 1b3c on RCSB PDB site
Description: solution structure of a beta-neurotoxin from the new world scorpion centruroides sculpturatus ewing
Class: toxin
Keywords: scorpion neurotoxin, new world toxin
Deposited on 1998-12-08, released 1998-12-16
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: protein (neurotoxin cse-I)
  Species: Centruroides sculpturatus [TaxId:218467]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P01491 (0-63)
  Domains in SCOPe 2.08: d1b3ca_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1b3cA (A:)
  kdgylvektgckktcyklgendfcnreckwkhiggsygycygfgcyceglpdstqtwplp
  nktc