PDB entry 1b3b

View 1b3b on RCSB PDB site
Description: thermotoga maritima glutamate dehydrogenase mutant n97d, g376k
Class: oxidoreductase
Keywords: metabolic role, glutamate, dehydrogenase, mutant, oxidoreductase
Deposited on 1998-12-07, released 1999-12-08
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 3.1 Å
R-factor: 0.225
AEROSPACI score: 0.19 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (glutamate dehydrogenase)
    Species: Thermotoga maritima [TaxId:2336]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P96110
      • engineered (96)
      • engineered (375)
    Domains in SCOPe 2.07: d1b3ba1, d1b3ba2
  • Chain 'B':
    Compound: protein (glutamate dehydrogenase)
    Species: Thermotoga maritima [TaxId:2336]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P96110
      • engineered (96)
      • engineered (375)
    Domains in SCOPe 2.07: d1b3bb1, d1b3bb2
  • Chain 'C':
    Compound: protein (glutamate dehydrogenase)
    Species: Thermotoga maritima [TaxId:2336]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P96110
      • engineered (96)
      • engineered (375)
    Domains in SCOPe 2.07: d1b3bc1, d1b3bc2
  • Chain 'D':
    Compound: protein (glutamate dehydrogenase)
    Species: Thermotoga maritima [TaxId:2336]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P96110
      • engineered (96)
      • engineered (375)
    Domains in SCOPe 2.07: d1b3bd1, d1b3bd2
  • Chain 'E':
    Compound: protein (glutamate dehydrogenase)
    Species: Thermotoga maritima [TaxId:2336]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P96110
      • engineered (96)
      • engineered (375)
    Domains in SCOPe 2.07: d1b3be1, d1b3be2
  • Chain 'F':
    Compound: protein (glutamate dehydrogenase)
    Species: Thermotoga maritima [TaxId:2336]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P96110
      • engineered (96)
      • engineered (375)
    Domains in SCOPe 2.07: d1b3bf1, d1b3bf2

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1b3bA (A:)
    pekslyemaveqfnraaslmdlesdlaevlrrpkrvlivefpvrmddghvevftgyrvqh
    nvargpakggiryhpdvtldevkalafwmtwktavmdlpfgggkggvrvdpkklsrnele
    rlsrrffseiqviigpyndipapdvntnadviawymdtysmnvghtvlgivtgkpvelgg
    skgreeatgrgvkvcaglamdvlgidpkkatvavqgfgnvgqfaallisqelgskvvavs
    dsrggiynpegfdveelirykkehgtvvtypkgeritneelleldvdilvpaalegaiha
    gnaerikakavvegangpttpeadeilsrrgilvvpdilanaggvtvsyfewvqdlqsff
    wdldqvrnalekmmkkafndvmkvkekynvdmrtaayilaidrvayatkkrgiyp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1b3bA (A:)
    slyemaveqfnraaslmdlesdlaevlrrpkrvlivefpvrmddghvevftgyrvqhnva
    rgpakggiryhpdvtldevkalafwmtwktavmdlpfgggkggvrvdpkklsrnelerls
    rrffseiqviigpyndipapdvntnadviawymdtysmnvghtvlgivtgkpvelggskg
    reeatgrgvkvcaglamdvlgidpkkatvavqgfgnvgqfaallisqelgskvvavsdsr
    ggiynpegfdveelirykkehgtvvtypkgeritneelleldvdilvpaalegaihagna
    erikakavvegangpttpeadeilsrrgilvvpdilanaggvtvsyfewvqdlqsffwdl
    dqvrnalekmmkkafndvmkvkekynvdmrtaayilaidrvayatkkrg
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1b3bB (B:)
    pekslyemaveqfnraaslmdlesdlaevlrrpkrvlivefpvrmddghvevftgyrvqh
    nvargpakggiryhpdvtldevkalafwmtwktavmdlpfgggkggvrvdpkklsrnele
    rlsrrffseiqviigpyndipapdvntnadviawymdtysmnvghtvlgivtgkpvelgg
    skgreeatgrgvkvcaglamdvlgidpkkatvavqgfgnvgqfaallisqelgskvvavs
    dsrggiynpegfdveelirykkehgtvvtypkgeritneelleldvdilvpaalegaiha
    gnaerikakavvegangpttpeadeilsrrgilvvpdilanaggvtvsyfewvqdlqsff
    wdldqvrnalekmmkkafndvmkvkekynvdmrtaayilaidrvayatkkrgiyp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1b3bB (B:)
    slyemaveqfnraaslmdlesdlaevlrrpkrvlivefpvrmddghvevftgyrvqhnva
    rgpakggiryhpdvtldevkalafwmtwktavmdlpfgggkggvrvdpkklsrnelerls
    rrffseiqviigpyndipapdvntnadviawymdtysmnvghtvlgivtgkpvelggskg
    reeatgrgvkvcaglamdvlgidpkkatvavqgfgnvgqfaallisqelgskvvavsdsr
    ggiynpegfdveelirykkehgtvvtypkgeritneelleldvdilvpaalegaihagna
    erikakavvegangpttpeadeilsrrgilvvpdilanaggvtvsyfewvqdlqsffwdl
    dqvrnalekmmkkafndvmkvkekynvdmrtaayilaidrvayatkkrg
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1b3bC (C:)
    pekslyemaveqfnraaslmdlesdlaevlrrpkrvlivefpvrmddghvevftgyrvqh
    nvargpakggiryhpdvtldevkalafwmtwktavmdlpfgggkggvrvdpkklsrnele
    rlsrrffseiqviigpyndipapdvntnadviawymdtysmnvghtvlgivtgkpvelgg
    skgreeatgrgvkvcaglamdvlgidpkkatvavqgfgnvgqfaallisqelgskvvavs
    dsrggiynpegfdveelirykkehgtvvtypkgeritneelleldvdilvpaalegaiha
    gnaerikakavvegangpttpeadeilsrrgilvvpdilanaggvtvsyfewvqdlqsff
    wdldqvrnalekmmkkafndvmkvkekynvdmrtaayilaidrvayatkkrgiyp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1b3bC (C:)
    slyemaveqfnraaslmdlesdlaevlrrpkrvlivefpvrmddghvevftgyrvqhnva
    rgpakggiryhpdvtldevkalafwmtwktavmdlpfgggkggvrvdpkklsrnelerls
    rrffseiqviigpyndipapdvntnadviawymdtysmnvghtvlgivtgkpvelggskg
    reeatgrgvkvcaglamdvlgidpkkatvavqgfgnvgqfaallisqelgskvvavsdsr
    ggiynpegfdveelirykkehgtvvtypkgeritneelleldvdilvpaalegaihagna
    erikakavvegangpttpeadeilsrrgilvvpdilanaggvtvsyfewvqdlqsffwdl
    dqvrnalekmmkkafndvmkvkekynvdmrtaayilaidrvayatkkrg
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1b3bD (D:)
    pekslyemaveqfnraaslmdlesdlaevlrrpkrvlivefpvrmddghvevftgyrvqh
    nvargpakggiryhpdvtldevkalafwmtwktavmdlpfgggkggvrvdpkklsrnele
    rlsrrffseiqviigpyndipapdvntnadviawymdtysmnvghtvlgivtgkpvelgg
    skgreeatgrgvkvcaglamdvlgidpkkatvavqgfgnvgqfaallisqelgskvvavs
    dsrggiynpegfdveelirykkehgtvvtypkgeritneelleldvdilvpaalegaiha
    gnaerikakavvegangpttpeadeilsrrgilvvpdilanaggvtvsyfewvqdlqsff
    wdldqvrnalekmmkkafndvmkvkekynvdmrtaayilaidrvayatkkrgiyp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1b3bD (D:)
    slyemaveqfnraaslmdlesdlaevlrrpkrvlivefpvrmddghvevftgyrvqhnva
    rgpakggiryhpdvtldevkalafwmtwktavmdlpfgggkggvrvdpkklsrnelerls
    rrffseiqviigpyndipapdvntnadviawymdtysmnvghtvlgivtgkpvelggskg
    reeatgrgvkvcaglamdvlgidpkkatvavqgfgnvgqfaallisqelgskvvavsdsr
    ggiynpegfdveelirykkehgtvvtypkgeritneelleldvdilvpaalegaihagna
    erikakavvegangpttpeadeilsrrgilvvpdilanaggvtvsyfewvqdlqsffwdl
    dqvrnalekmmkkafndvmkvkekynvdmrtaayilaidrvayatkkrg
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1b3bE (E:)
    pekslyemaveqfnraaslmdlesdlaevlrrpkrvlivefpvrmddghvevftgyrvqh
    nvargpakggiryhpdvtldevkalafwmtwktavmdlpfgggkggvrvdpkklsrnele
    rlsrrffseiqviigpyndipapdvntnadviawymdtysmnvghtvlgivtgkpvelgg
    skgreeatgrgvkvcaglamdvlgidpkkatvavqgfgnvgqfaallisqelgskvvavs
    dsrggiynpegfdveelirykkehgtvvtypkgeritneelleldvdilvpaalegaiha
    gnaerikakavvegangpttpeadeilsrrgilvvpdilanaggvtvsyfewvqdlqsff
    wdldqvrnalekmmkkafndvmkvkekynvdmrtaayilaidrvayatkkrgiyp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1b3bE (E:)
    slyemaveqfnraaslmdlesdlaevlrrpkrvlivefpvrmddghvevftgyrvqhnva
    rgpakggiryhpdvtldevkalafwmtwktavmdlpfgggkggvrvdpkklsrnelerls
    rrffseiqviigpyndipapdvntnadviawymdtysmnvghtvlgivtgkpvelggskg
    reeatgrgvkvcaglamdvlgidpkkatvavqgfgnvgqfaallisqelgskvvavsdsr
    ggiynpegfdveelirykkehgtvvtypkgeritneelleldvdilvpaalegaihagna
    erikakavvegangpttpeadeilsrrgilvvpdilanaggvtvsyfewvqdlqsffwdl
    dqvrnalekmmkkafndvmkvkekynvdmrtaayilaidrvayatkkrg
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1b3bF (F:)
    pekslyemaveqfnraaslmdlesdlaevlrrpkrvlivefpvrmddghvevftgyrvqh
    nvargpakggiryhpdvtldevkalafwmtwktavmdlpfgggkggvrvdpkklsrnele
    rlsrrffseiqviigpyndipapdvntnadviawymdtysmnvghtvlgivtgkpvelgg
    skgreeatgrgvkvcaglamdvlgidpkkatvavqgfgnvgqfaallisqelgskvvavs
    dsrggiynpegfdveelirykkehgtvvtypkgeritneelleldvdilvpaalegaiha
    gnaerikakavvegangpttpeadeilsrrgilvvpdilanaggvtvsyfewvqdlqsff
    wdldqvrnalekmmkkafndvmkvkekynvdmrtaayilaidrvayatkkrgiyp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1b3bF (F:)
    slyemaveqfnraaslmdlesdlaevlrrpkrvlivefpvrmddghvevftgyrvqhnva
    rgpakggiryhpdvtldevkalafwmtwktavmdlpfgggkggvrvdpkklsrnelerls
    rrffseiqviigpyndipapdvntnadviawymdtysmnvghtvlgivtgkpvelggskg
    reeatgrgvkvcaglamdvlgidpkkatvavqgfgnvgqfaallisqelgskvvavsdsr
    ggiynpegfdveelirykkehgtvvtypkgeritneelleldvdilvpaalegaihagna
    erikakavvegangpttpeadeilsrrgilvvpdilanaggvtvsyfewvqdlqsffwdl
    dqvrnalekmmkkafndvmkvkekynvdmrtaayilaidrvayatkkrg