PDB entry 1b3a

View 1b3a on RCSB PDB site
Description: total chemical synthesis and high-resolution crystal structure of the potent anti-hiv protein aop-rantes
Deposited on 1998-12-07, released 1999-04-23
The last revision prior to the SCOP 1.55 freeze date was dated 1999-04-23, with a file datestamp of 1999-04-22.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.175
AEROSPACI score: 0.61 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.55: d1b3aa_
  • Chain 'B':
    Domains in SCOP 1.55: d1b3ab_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1b3aA (A:)
pyssdttpccfayiarplprahikeyfytsgkcsnpavvfvtrknrqvcanpekkwvrey
inslems

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1b3aB (B:)
pyssdttpccfayiarplprahikeyfytsgkcsnpavvfvtrknrqvcanpekkwvrey
inslems