PDB entry 1b3a

View 1b3a on RCSB PDB site
Description: total chemical synthesis and high-resolution crystal structure of the potent anti-hiv protein aop-rantes
Class: anti-hiv protein
Keywords: chemical protein synthesis, chemokine, hiv-1, rantes, anti-hiv protein
Deposited on 1998-12-07, released 1999-04-23
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-10-04, with a file datestamp of 2017-09-29.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: N/A
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: protein (rantes)
  Database cross-references and differences (RAF-indexed):
  • Uniprot P13501 (0-66)
  Domains in SCOPe 2.08: d1b3aa_
• Chain 'B':
  Compound: protein (rantes)
  Database cross-references and differences (RAF-indexed):
  • Uniprot P13501 (0-66)
  Domains in SCOPe 2.08: d1b3ab_
• Heterogens: SO4, AOP, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1b3aA (A:)
  pyssdttpccfayiarplprahikeyfytsgkcsnpavvfvtrknrqvcanpekkwvrey
  inslems
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1b3aB (B:)
  pyssdttpccfayiarplprahikeyfytsgkcsnpavvfvtrknrqvcanpekkwvrey
  inslems