PDB entry 1b37

View 1b37 on RCSB PDB site
Description: a 30 angstrom u-shaped catalytic tunnel in the crystal structure of polyamine oxidase
Class: oxidoreductase
Keywords: flavin-dependent amine oxidase, oxidoreductase
Deposited on 1998-12-17, released 1999-12-17
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.199
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (polyamine oxidase)
    Species: Zea mays [TaxId:4577]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1b37a1, d1b37a2
  • Chain 'B':
    Compound: protein (polyamine oxidase)
    Species: Zea mays [TaxId:4577]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1b37b1, d1b37b2
  • Chain 'C':
    Compound: protein (polyamine oxidase)
    Species: Zea mays [TaxId:4577]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1b37c1, d1b37c2
  • Heterogens: NAG, FAD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1b37A (A:)
    atvgprvivvgagmsgisaakrlseagitdllileatdhiggrmhktnfaginvelganw
    vegvnggkmnpiwpivnstlklrnfrsdfdylaqnvykedggvydedyvqkrieladsve
    emgeklsatlhasgrddmsilamqrlnehqpngpatpvdmvvdyykfdyefaepprvtsl
    qntvplatfsdfgddvyfvadqrgyeavvyylagqylktddksgkivdprlqlnkvvrei
    kyspggvtvktednsvysadyvmvsaslgvlqsdliqfkpklptwkvraiyqfdmavytk
    iflkfprkfwpegkgrefflyassrrgyygvwqefekqypdanvllvtvtdeesrrieqq
    sdeqtkaeimqvlrkmfpgkdvpdatdilvprwwsdrfykgtfsnwpvgvnryeydqlra
    pvgrvyftgehtsehyngyvhgaylsgidsaeilincaqkkmckyhvqgkyd
    

    Sequence, based on observed residues (ATOM records): (download)
    >1b37A (A:)
    prvivvgagmsgisaakrlseagitdllileatdhiggrmhktnfaginvelganwvegv
    nggkmnpiwpivnstlklrnfrsdfdylaqnvykedggvydedyvqkrieladsveemge
    klsatlhasgrddmsilamqrlnehqpngpatpvdmvvdyykfdyefaepprvtslqntv
    platfsdfgddvyfvadqrgyeavvyylagqylktddksgkivdprlqlnkvvreikysp
    ggvtvktednsvysadyvmvsaslgvlqsdliqfkpklptwkvraiyqfdmavytkiflk
    fprkfwpegkgrefflyassrrgyygvwqefekqypdanvllvtvtdeesrrieqqsdeq
    tkaeimqvlrkmfpgkdvpdatdilvprwwsdrfykgtfsnwpvgvnryeydqlrapvgr
    vyftgehtsehyngyvhgaylsgidsaeilincaqkkmc
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1b37B (B:)
    atvgprvivvgagmsgisaakrlseagitdllileatdhiggrmhktnfaginvelganw
    vegvnggkmnpiwpivnstlklrnfrsdfdylaqnvykedggvydedyvqkrieladsve
    emgeklsatlhasgrddmsilamqrlnehqpngpatpvdmvvdyykfdyefaepprvtsl
    qntvplatfsdfgddvyfvadqrgyeavvyylagqylktddksgkivdprlqlnkvvrei
    kyspggvtvktednsvysadyvmvsaslgvlqsdliqfkpklptwkvraiyqfdmavytk
    iflkfprkfwpegkgrefflyassrrgyygvwqefekqypdanvllvtvtdeesrrieqq
    sdeqtkaeimqvlrkmfpgkdvpdatdilvprwwsdrfykgtfsnwpvgvnryeydqlra
    pvgrvyftgehtsehyngyvhgaylsgidsaeilincaqkkmckyhvqgkyd
    

    Sequence, based on observed residues (ATOM records): (download)
    >1b37B (B:)
    prvivvgagmsgisaakrlseagitdllileatdhiggrmhktnfaginvelganwvegv
    nggkmnpiwpivnstlklrnfrsdfdylaqnvykedggvydedyvqkrieladsveemge
    klsatlhasgrddmsilamqrlnehqpngpatpvdmvvdyykfdyefaepprvtslqntv
    platfsdfgddvyfvadqrgyeavvyylagqylktddksgkivdprlqlnkvvreikysp
    ggvtvktednsvysadyvmvsaslgvlqsdliqfkpklptwkvraiyqfdmavytkiflk
    fprkfwpegkgrefflyassrrgyygvwqefekqypdanvllvtvtdeesrrieqqsdeq
    tkaeimqvlrkmfpgkdvpdatdilvprwwsdrfykgtfsnwpvgvnryeydqlrapvgr
    vyftgehtsehyngyvhgaylsgidsaeilincaqkkmckyh
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1b37C (C:)
    atvgprvivvgagmsgisaakrlseagitdllileatdhiggrmhktnfaginvelganw
    vegvnggkmnpiwpivnstlklrnfrsdfdylaqnvykedggvydedyvqkrieladsve
    emgeklsatlhasgrddmsilamqrlnehqpngpatpvdmvvdyykfdyefaepprvtsl
    qntvplatfsdfgddvyfvadqrgyeavvyylagqylktddksgkivdprlqlnkvvrei
    kyspggvtvktednsvysadyvmvsaslgvlqsdliqfkpklptwkvraiyqfdmavytk
    iflkfprkfwpegkgrefflyassrrgyygvwqefekqypdanvllvtvtdeesrrieqq
    sdeqtkaeimqvlrkmfpgkdvpdatdilvprwwsdrfykgtfsnwpvgvnryeydqlra
    pvgrvyftgehtsehyngyvhgaylsgidsaeilincaqkkmckyhvqgkyd
    

    Sequence, based on observed residues (ATOM records): (download)
    >1b37C (C:)
    prvivvgagmsgisaakrlseagitdllileatdhiggrmhktnfaginvelganwvegv
    nggkmnpiwpivnstlklrnfrsdfdylaqnvykedggvydedyvqkrieladsveemge
    klsatlhasgrddmsilamqrlnehqpngpatpvdmvvdyykfdyefaepprvtslqntv
    platfsdfgddvyfvadqrgyeavvyylagqylktddksgkivdprlqlnkvvreikysp
    ggvtvktednsvysadyvmvsaslgvlqsdliqfkpklptwkvraiyqfdmavytkiflk
    fprkfwpegkgrefflyassrrgyygvwqefekqypdanvllvtvtdeesrrieqqsdeq
    tkaeimqvlrkmfpgkdvpdatdilvprwwsdrfykgtfsnwpvgvnryeydqlrapvgr
    vyftgehtsehyngyvhgaylsgidsaeilincaqkkmckyh